DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir56d

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_611432.1 Gene:Ir56d FlyBaseID:FBgn0034458 Length:632 Species:Drosophila melanogaster

Alignment Length:681 Identity:128/682 (19%)
Similarity:241/682 (35%) Gaps:223/682 (33%)


  Fly    18 NRLVQTVQELNNIYQTELNVFLEFGNGADILESAQGTFVPTLWIKNPQNQKVMKGNFTSCTLTIL 82
            ||..:.:....||:.|         ||:|.:......||..::.:                :|.|
  Fly     3 NRAAELILRERNIFPT---------NGSDNITLLNNMFVLEMFYR----------------ITQL 42

  Fly    83 YLEDEHLDRGLYYLANWL--------------WEY------------HHL-----------EVLI 110
            |    |....::|::..|              |.|            |||           .:::
  Fly    43 Y----HFKNFIFYISERLDLNNKDSQEFFHNFWTYFPMAPNLIITREHHLGIPMMQFISTPSLVM 103

  Fly   111 FFNGGSYDKLIQIFSR-------------------------------------------CFNEGF 132
            .|..|..|.::::.|.                                           .:.:.|
  Fly   104 VFTTGKDDPIMELASHNQQGIHWLKTIFVLFPSLQSRDFETNPESLAQFTAEIKDVYDWVWRKQF 168

  Fly   133 VNVLVMLPGSDELYTFMPYQDLKILNLKSI---KEFYSLSRKKMDLNGYNITSGLVIAGAPRWFS 194
            :|.. ::...|.::...||....|:|...:   :||:....|.|  .||.:.:. ::...||.|.
  Fly   169 INTF-LITIKDNVFILDPYPTPSIVNKTGVWQAEEFFHKYAKNM--KGYLVRTP-ILYDMPRVFK 229

  Fly   195 F---RDRQNRLILTGYMLRMIVDFTNHFNGSVRLMNVLTVNDGLELLANRTIDFFPFLIRPLKSF 256
            .   .:|..:..:.|....:.:.|....|.::           ::..||.|.|:          .
  Fly   230 SDRPTNRYEKNFIHGTSGNLFLGFLEFVNATL-----------MDTSANVTADY----------L 273

  Fly   257 SMSNILYL------------------------------ENCGLIVPTSRPLPNWVYLLRPYAFDT 291
            :|:|:|.|                              .:|.::||.....|...|:......:.
  Fly   274 NMTNLLDLVSQGVYETLIHSFTEITTKFVVSYSYPIGINDCCIMVPYRNQSPADQYMHEALQENV 338

  Fly   292 WIAWLIMLIYCSLALRILSK-GQISISAAFLKVLRLVMYLSGSRDMGTRPTTRRLFLFVILTTSG 355
            |:...:..:|.::|:.:.|. ....:|||||:.:..:.|...:..:.| ||.|..:|:::|...|
  Fly   339 WVLISLFTLYITVAIYLCSPLRPRDLSAAFLQSICTLTYSVPTFIIRT-PTLRMRYLYILLAIWG 402

  Fly   356 FILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEK---LIPD----RTKLL 413
            .:.:|||:::::|........:||||.:|:.:::....::.::.:.|.|   ..|:    :..|:
  Fly   403 IVTSNLYISRMTSYFTTAPPVRQINTVQDVVEANLRIKMLAIEYERMAKSPLQYPESYLNQVDLV 467

  Fly   414 KKIVPTLEADVDTYRRNLNTSCIHSGFFDRIDFALYQQKFLRFPIFR-----------KFP---- 463
            .|.:      :|.:|...|||..::...||..|...||..||.||||           .||    
  Fly   468 DKHM------LDLHRDPFNTSFGYTVSSDRWRFLNLQQLHLRKPIFRLTEICEGPFYHVFPLHKD 526

  Fly   464 -HL--LYQQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLE 525
             |:  :..:.:.|:...|     |.|.:.|:.|...::|        |.|...|    |.|   |
  Fly   527 SHMRSVMTEYIMIAQQAG-----LMNHWERETFWEAVHL--------HRIHVHL----FDD---E 571

  Fly   526 VKSNDVEYYYLIAGLWFGGLTLATVCFLLEL 556
            ..:..::::..:...|..||.||.:.|..|:
  Fly   572 PMALSLDFFSSLLRTWTLGLILAGLAFAAEM 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67bNP_648393.1 None
Ir56dNP_611432.1 ATPase-IIIA_H <312..422 CDD:273731 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.