DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir54a

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_611259.2 Gene:Ir54a FlyBaseID:FBgn0034272 Length:586 Species:Drosophila melanogaster

Alignment Length:573 Identity:124/574 (22%)
Similarity:234/574 (41%) Gaps:113/574 (20%)


  Fly    55 FVPTLWIKNP-QNQK----VMKGNFT-------SCTLTILYLEDEHLDRGLYYLANW---LWEYH 104
            :.|..|.|:. :||.    |:..:.|       |..|.:..|....|.:.|..|.|:   |.::.
  Fly    42 YCPYNWAKDIFENQTIPVVVLSDSETFINIRMFSRPLHVACLPGHELQKDLALLENFTSSLMDFP 106

  Fly   105 HLEVLIFFNGGSYD--KLIQIFSRCFNEGFVNVLVMLPGSDE---LYTFMPYQDLKILNLKSIKE 164
            ..:.:::.:....|  ::..||..|::....|::.:| .|||   .|.:..|...: ...:|::.
  Fly   107 SQKKIVYISNNFSDPTRMDYIFETCYHRRIWNIVGLL-ASDEHRYFYRYHLYPSFR-TEYRSLES 169

  Fly   165 FYSLSRKKMDLNGYNITSGLVIAGAPRWFSFRDRQ-NRLILTGYMLRMIVDFTNHFNGSVRLMNV 228
            .....:...:::|:.:|. :.....||...:.||: .:.||.|.:.|.....:...|.:::|...
  Fly   170 STIFDKDFPNMHGHPLTV-MPDQWLPRSVLYVDRRTGKQILAGSVGRFFHVLSWKLNATLQLSKK 233

  Fly   229 LTVNDGL------ELLANRTIDF---FPFLIRPLKSFSMSNILYLENCGLIVPTSRPLP-NWVYL 283
            :|....|      ||..:.::|.   ...:.|..:..|.|..:.:.:..|:||.:|.:| ..:|.
  Fly   234 VTTGRFLNATALKELSESFSVDVPASLTIMERVEQLASTSYPMEVTHVCLMVPVARRIPIKDIYF 298

  Fly   284 LRPYAFDTWIAWLIMLIYCSLALRIL---SKGQISISAAFL--KVLRLVM----YLSGSRDMGTR 339
            :...|.:.::|.:|:..| .|||.:|   :...:.:....|  |.||.::    .|..||...||
  Fly   299 ILSSASNMFLAIVIVSSY-GLALNLLRNMTHRDVRLVDFVLNDKALRGILGQSFNLPLSRSFSTR 362

  Fly   340 PTTRRLFLFVILTTSGFILTNLYVA-----------QLSSNSAAGLYEKQINTWEDLDKSDSIWP 393
                  .:|::|...|..:::::.|           |..:.|.|||...:|             |
  Fly   363 ------LIFLMLGIVGLNVSSIFGAGLDTLMAHPPRQFQARSFAGLRRTKI-------------P 408

  Fly   394 LIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTY---RRNLNTSCIHSGFFDRIDFALYQQKFLR 455
            |:     |.|:..|...||.   ||.|..:|..|   |...|||  ::.|..|:.:.|:.::..|
  Fly   409 LV-----TTEEDFPTWMKLR---VPMLVVNVSEYNHLRNGRNTS--NAYFASRLYWNLFSEQQKR 463

  Fly   456 FP----IFR------KFPHLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGIY-----LKMKD-- 503
            |.    |:.      ....|.:|.|.  ::.|..|..||    :.::..:|:|     :...|  
  Fly   464 FTRELFIYSTDDCLWSLALLSFQWPQ--NSLFTEPVSQL----ILEVNANGLYDFWVGMHYYDMT 522

  Fly   504 DAYRHGIQSGLLNLAFRDRHLEVKSNDVEYYYLIAGLWFGGLTLATVCFLLEL 556
            .|...|::...|.|..|:....::..|.::.:...|.:   :.:|.:.||||:
  Fly   523 AAGLSGLEDPSLQLKEREHPTSLRIVDFQWMWQAYGTF---MVIAILVFLLEV 572



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.