DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir52d

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_611042.2 Gene:Ir52d FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster

Alignment Length:598 Identity:121/599 (20%)
Similarity:199/599 (33%) Gaps:211/599 (35%)


  Fly   118 DKLIQIFSRCFNEGFVNVLVMLPGSDELYTFMP-------------------------------- 150
            ::|:.:..|...|.|.|.| ::.|.|..::.:.                                
  Fly    31 ERLLSLLLRLQQEQFFNTL-LIYGEDCAFSSLSRRLQVPTILVSSGSTSFEWNYSSLALILTCEF 94

  Fly   151 -------YQDLKIL-----------NLK--SIKEFYSLSRKKMDLNGYNITS--------GLVIA 187
                   ||.||.|           |:|  |:.:|||   ||   :.|||..        |::.|
  Fly    95 KAEREENYQTLKKLQMNRRLILLNGNIKPDSVCDFYS---KK---DQYNIAMVNNNFHQVGIIYA 153

  Fly   188 ----------------GAPRWF-SFRDRQNRLILT-----------------------GYMLRMI 212
                            |.|.:. .||:.|..|:.:                       ||:..::
  Fly   154 CRLFQERNYEKVYLSEGNPIYVDQFRNMQGALLKSITFNLIPGSMAYRDPKTGQEKHIGYVANLL 218

  Fly   213 VDFTNHFNGSVRLMNVLTVNDGLELLANRTIDFF---PFLIRPLKSFSMSNILYLE--------- 265
            .:|....|.::.:...|.       .|.:...|:   .:....|....||...|.|         
  Fly   219 NNFVEKVNATLDMQVKLH-------KAGKKTSFYNITKWASEDLVDIGMSYAAYFEMTNFDTISY 276

  Fly   266 ------NCGLIVPTSRPLPN-WVYLLRPYAFDTWIAWLIMLIYC--SLALRIL---SKGQISISA 318
                  .| .:||....:|| .:|:   ...|..:..:::.|:|  |:.|..:   |...:|:..
  Fly   277 PYLMTSTC-FMVPLPDMMPNSEIYM---GIVDPPVLVVLIAIFCIFSVMLNYIKQRSWRSLSLVN 337

  Fly   319 AFLKVLRLVMYLSGSRDMGTRPTTRRLFLFVILTT-SGFILTNLYVAQLSSNSAAGLYEKQINTW 382
            ..|..:.|..:|:..... .|.:.|:|.|..:|.. ...|.|.:|.:.|.|              
  Fly   338 VLLNDICLRGFLAQPFPF-PRQSNRKLKLISMLVCFFSVITTTMYTSYLQS-------------- 387

  Fly   383 EDLDKSDSIW-PLIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTYRRNLNTSCIHSGFFDRI-- 444
                   .:| |.||..:.:...|...|.||..:     ..|::.. |..|.|..|...||..  
  Fly   388 -------FMWGPPIDPKMCSFADLENSRYKLAIR-----RYDIEML-RPFNVSMDHVVVFDESSQ 439

  Fly   445 ---------DFALY------------QQKFLRFPIFRKFPHLLYQQPLQ-ISAAFGR--PYLQLF 485
                     |..:|            |||...||:| .:...|..:|:. .|....|  ||..||
  Fly   440 LEYLRDSFDDNYMYPMSALSWSAFKEQQKLFAFPLF-YYSEKLCLKPISFFSFPIRRHLPYRDLF 503

  Fly   486 NWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLA----FRDRHLE--VKSNDVEYYYLIAGLWFGG 544
            ...:.:..|.|:.....|.::...::   |.||    |....||  ::.:|:.:.:   |::|.|
  Fly   504 EEHMLQQNEFGLSTYWIDRSFSDMVR---LKLATMNDFSPPRLEDYIEVSDLSWVF---GMYFTG 562

  Fly   545 LTLATVCFLLELL 557
            |.::..||.||||
  Fly   563 LGISCCCFGLELL 575



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.