DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir52a

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_611041.2 Gene:Ir52a FlyBaseID:FBgn0034023 Length:599 Species:Drosophila melanogaster

Alignment Length:617 Identity:131/618 (21%)
Similarity:234/618 (38%) Gaps:117/618 (19%)


  Fly     6 LNTLQS--LSLLEGNRLVQTVQELNNIYQTELNVFLEFG--------------------NGADIL 48
            ||..||  |.||||: |.:.:..||  .:.|.|..|.:|                    :|:...
  Fly    21 LNYTQSRDLELLEGS-LFRVLSRLN--LEEEYNTLLIYGKECVFHSLLRKLEISAVTVPSGSTDY 82

  Fly    49 ESAQGTFVPTLW----IKNPQNQ-KVMKGNFTSCTLTILYLEDEHLDRGL---YYLANWLWEYHH 105
            :.:..|.:..|.    .:|.:|. .:||   ...|..::||||......:   |.|.    |.|:
  Fly    83 DWSFSTAILILSCGYDAENEENSYTLMK---LQRTRRLIYLEDNSEPESVCMRYSLK----EQHN 140

  Fly   106 LEVLIFFNGGSYDKLIQIFS-RCFN-----EGFVNVLVMLPGSDELYTFMPYQDLKILNLKSIKE 164
            :.::    ...:|:....:| |.|.     ||.               |...|.:.|.|.:::: 
  Fly   141 IAMV----KSDFDQSDTFYSCRLFQTPNYVEGH---------------FFKDQPIYIENFQNMR- 185

  Fly   165 FYSLSRKKMDLNGYNI---TSGLVIAGAPRWFSFRD-RQNRLILTGYMLRMIVDFTNHFNGSVRL 225
                        |..|   ...||    ||...:|| :.....:.||:..||..:....|..:..
  Fly   186 ------------GATIRTVADSLV----PRTILYRDEKSGETKMMGYLGHMINTYAQKLNAKLHF 234

  Fly   226 MNVL-------TVNDGLELLANRTIDFFPFLIRPLKSFSMSNILY---LENCGLIVPTSRPLP-N 279
            ::..       :|.|.:..:....:|....|...|:..:|.::.|   |....|:||....:| |
  Fly   235 IDTSKLGAKKPSVLDIMNWVNEDIVDIGTALASSLQFKNMDSVWYPYLLTGYCLMVPVPAKMPYN 299

  Fly   280 WVYLLRPYAFDTWIAWLIMLIYCSLALRI-----LSKGQISISAAFLKVLRLVMYLSGSRDMGTR 339
            .||.:   ..|..:..:|.::.|..::.|     ||...::::...|....|...|..|......
  Fly   300 LVYSM---IVDPLVLSIIFVMLCLFSVLIIYTQHLSWKNLTLANILLNDKSLRGLLGQSFPFPPN 361

  Fly   340 PTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEK 404
            |:.....:..:|..:..::|.:|.|.|.|.......|..|.::.|:..|.....:..:::..:..
  Fly   362 PSKHLKLIIFVLCFASVMITTMYEAYLQSYFTQPPSEPYIRSFRDIGNSSLKMAISRLEVNVLTS 426

  Fly   405 LIPDRTKLLKKIVPTLEADVDTY---RRNLNTSCIHSGFFDRIDFALYQQKFLRFPIFRKFPHLL 466
            |.....:.:.:....:..|:..|   |.:.|||.|.....||.:....|||....|.|....:|.
  Fly   427 LNNSHFREISEDHLLIFDDLSEYLVLRDSFNTSFIFPVSVDRWNGYEEQQKLFAEPAFYLATNLC 491

  Fly   467 YQQPLQISAAFGR--PYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNL--AFRDRHLEVK 527
            :.|.:..|....|  |:..||...:.:..|.|:....|..::...::.||.::  ..|.|:.||.
  Fly   492 FNQFMLFSPPLRRYLPHRHLFEDHMMRQHEFGLVTFWKSQSFIEMVRLGLASMEDLSRKRNEEVS 556

  Fly   528 --SNDVEYYYLIAGLWFGGLTLATVCFLLELL 557
              .:|:.:   |..|:.|.:.:::.||:||:|
  Fly   557 LLLDDISW---ILKLYLGAMFISSFCFILEIL 585



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.