DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir48b

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_610697.1 Gene:Ir48b FlyBaseID:FBgn0033648 Length:600 Species:Drosophila melanogaster

Alignment Length:613 Identity:141/614 (23%)
Similarity:257/614 (42%) Gaps:122/614 (20%)


  Fly     2 ELLYLNTLQSLSLLEGNRLVQTVQELNNIYQTELN------VFLEFGNGA---DILESAQGTFVP 57
            |:.||..:..:||     ::.|..|..|..|.|.|      :||..||..   |.|.:....|  
  Fly    56 EIKYLQHMPPISL-----MIFTSIESMNFTQVEYNLGADNKLFLIMGNEEPPYDFLHALNLHF-- 113

  Fly    58 TLWIKNPQNQKVMKGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLEVLIFFNGGSYDKLIQ 122
                           .|....:.|    ||.:|  |.....||...:||                
  Fly   114 ---------------QFAEYIIVI----DEPVD--LKKSTKWLDFVNHL---------------- 141

  Fly   123 IFSRCFNEGFVNVLVMLPGSDELYTFMPYQDLKILNLKSIKEFYSLSRKKMDLNGYNITSGLVIA 187
                 :.:|:|.:|:.....::||..:.:.: .::....::::.|:.....:|.||.:.   |.|
  Fly   142 -----WQQGYVQLLIYTSYDEKLYHKIIFPE-TVIEETLVEQYISIRGSFNNLYGYPVR---VAA 197

  Fly   188 --GAPRWFSFRDRQNRLILTGYMLRMIVDFTNHFNGSVRLMNVLTVNDG-----LELLANRTIDF 245
              .|||...:.:|..:.|..|:.:|.:..|.:..|||  .:.|||.::.     |.|: |.|:|.
  Fly   198 YNNAPRSMLYVNRWGKHIFAGFYMRFLRAFIDARNGS--FVPVLTPSNSPGNCTLNLV-NETVDV 259

  Fly   246 -FPFLIRPLKSFSMSNILYLENCGLIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRIL 309
             ...|.....:||:::...:.:..::|..::||.::.||..|:   .|..|..::||..|.:..|
  Fly   260 CADALAANPAAFSLTHGFRIASANVLVTHAKPLHSYRYLTAPF---QWSVWACLVIYVLLVVNFL 321

  Fly   310 S------KGQISISAAFLKVLRLVM----YLSGSRDMGTRPTTRRLFLFVILTTSGFILTNLYVA 364
            |      .|:...|...|:|...::    ||...|.      ..|..||.:|..:||:.:..|:.
  Fly   322 SFIGWLRSGKWEFSKYLLEVFSSLLFSGFYLKEIRG------RERYILFGVLFIAGFVYSTEYLG 380

  Fly   365 QLSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEKLIPDRTKLLKKIVPTLE-ADVDT-- 426
            .|.|...:.::||||:|:|.|.:|:     |.:.:...:|::..:..:.:.:.|.:| ...:|  
  Fly   381 LLKSMLISEVFEKQIDTFEALVESN-----ITLMVDPYDKILFAKYNMPEILSPIMELVSFETLL 440

  Fly   427 -YRRNLNTSCIHSGFFDRIDFALYQQKFLRFPIFRKFPHLLYQQPLQISAAF-GRPYLQLFNWFV 489
             :|...:....:..|.||:....|.|:||:.|       .|.:.|:..|..: |.|..:  .||:
  Fly   441 KHRNRFDQDYAYILFSDRMALYDYAQQFLKHP-------KLLRIPIDFSFLYTGIPMRK--RWFL 496

  Fly   490 RK--------IFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVEYYYLIAGLWFGGLT 546
            :.        .||||:..|:..||....::.|.|:....: |:|.:..:|:|:.:.|.....|..
  Fly   497 KHHLGRAWYWAFESGLTRKLALDADFEAVRVGYLSFLITE-HVEAQPLNVDYFVMPAIALAIGYI 560

  Fly   547 LATVCFLLELLIGYAKIKVTISCKMNIM 574
            ||.:.|::|:...  :|:..:.|:...|
  Fly   561 LALLSFVIEMTAW--RIREFLGCRKATM 586



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.