DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir20a

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_608456.1 Gene:Ir20a FlyBaseID:FBgn0031181 Length:563 Species:Drosophila melanogaster

Alignment Length:631 Identity:136/632 (22%)
Similarity:231/632 (37%) Gaps:163/632 (26%)


  Fly    18 NRLVQTVQELNNIYQTELNVFLEFGNGADI-------LESAQGTFVPTLWIKN--PQNQKVMKGN 73
            ||......||.::|...:: ||..|....:       |:.:.|    .||.:|  ...|.|.:.|
  Fly     6 NRSTGLSAELLDLYGLVVH-FLLSGEHTTLVYFNPAGLDCSWG----VLWQRNLTAHPQIVWQRN 65

  Fly    74 FT--------SCTLTILYL--EDEHLDRGLYYLANWLWEYHHL----EVLIFFNGGSYDKLI-QI 123
            ::        :..|.:|..  .|......|..|||.|   .||    .:||...|.....|. |.
  Fly    66 YSYPDLYYQFNAKLLVLACLPMDSRAAIQLEILANSL---SHLRTVVRLLIEVAGPDQVTLARQY 127

  Fly   124 FSRCFNEGFVNVLVMLPGSDELYTFMPYQDLKIL-NLKSIKEFYSLSR-------------KKMD 174
            .|.|.....::|        ||| |..|....|| :.::...|..:.|             |..|
  Fly   128 LSFCLRRSMLHV--------ELY-FRDYHHSLILYSFRAFPSFELVMRWISVGQGVKLFLHKLDD 183

  Fly   175 LNGYNITSGLVI--AGAPRWFSFRDRQNRLILTGYMLRMIVDFTNHFNGSVRLMNVLTVNDGLEL 237
            |.|:.:.   ||  ...|..|.:||.:....:|||:.    ||...|.|        .:|.||| 
  Fly   184 LRGHRLR---VIPDLSPPNTFFYRDARGDNQVTGYLW----DFLATFAG--------RLNAGLE- 232

  Fly   238 LANRTIDFFPFLIRP-LKSFSMSNILY--------LENCGLIVPTSRPLPNW-VYLLRPYAFDTW 292
                       ::|| .::.|.|:..|        |.:.||   |:..:..| ::.:..|.:...
  Fly   233 -----------VVRPSWRAGSASDSSYMLEYSAKGLIDVGL---TTTLITKWNLWAIHQYTYPLL 283

  Fly   293 I-AWLIML--------------IYC-SLALRILSKGQISISAAFLKVLRLVMYLSGSRDMGTRPT 341
            : :|..||              |.| :||:.:|.  .|.::....:.||.:..|..||.....| 
  Fly   284 VSSWCTMLPVEKPLATPDLFGRIVCPTLAMTLLL--IILVTWLVFRQLRCLTRLKNSRPARIVP- 345

  Fly   342 TRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEKLI 406
              .|...::|||..        |||.|......|..:|.::|||.:.|             :|::
  Fly   346 --HLLTLLLLTTCS--------AQLLSLLIFPPYHVRIASFEDLLRGD-------------QKIL 387

  Fly   407 PDRTKLLK----------KIVPTLEADVDTY--RRNLNTSCIHSGFFDRIDFALYQQKFLRFPIF 459
            ..|.:...          .:...::...:.|  |.:.||:..::..:.:......||:....|:|
  Fly   388 GMRNEFYNFDGAFRARYAGVFYLIDDPNELYDLRNHFNTTWAYTMPYIKWLVIKTQQRHFSKPLF 452

  Fly   460 RKFPHLLY--QQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLA-FRD 521
            |....|.:  ..|..:..|....|.:....|..:|.::|:.......::...|::|.:::. :.|
  Fly   453 RWSKDLCFFDFMPTSVIVAPDSIYWESIKDFTFRIHQAGLMKHWIRKSFYDMIKAGKMSIKDYSD 517

  Fly   522 RHLE----VKSNDVEYYYLIAGLWFGGLTLATVCFLLELLIGYAKI 563
              ||    :...|:|..:.:.|   ..:.:|:..|::|||..|..:
  Fly   518 --LETLKPLNIGDLEIVWRVCG---AAIAVASAIFIMELLYFYINV 558



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.