DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir10a

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001096949.1 Gene:Ir10a FlyBaseID:FBgn0083979 Length:600 Species:Drosophila melanogaster

Alignment Length:663 Identity:134/664 (20%)
Similarity:238/664 (36%) Gaps:183/664 (28%)


  Fly     3 LLYLNTLQSLSLLEGNRLVQTVQELNNIYQTELNVFLEFGNGADILESAQ------GTFVPTLWI 61
            ||::..|::|:|...|.|:  |:...::.|.||  :|..|:.....|:..      .|.:|...:
  Fly     9 LLFMLDLKTLNLTRLNGLL--VEPTRDLPQLEL--WLRAGSDHQDAENPYVQWFLLRTEIPLSIV 69

  Fly    62 KNPQNQKVMKGNFTSCTLTILYLEDEHL-DRG-----------LYYLAN---------------- 98
            ...:|:..|...|....|.::...|:.| :||           .|.||:                
  Fly    70 TYQENRYWMDDPFGRRNLVLVMSLDQLLTNRGAAAPIQKASTFFYILADQDKDLSADEQLRLEGS 134

  Fly    99 --WLWEYHHLEVLIFFNGGS---YDKLIQIFSRCFNEGFVNVLVMLPGSDELYTFMPYQDLKILN 158
              .||..|.:....|.....   ||.    |.|  .:.....||...||:.|...: ::|:....
  Fly   135 CRQLWTQHKVYNRFFLTRDGVWIYDP----FKR--RDSAFGRLVRYYGSETLDKLL-FRDMAGYP 192

  Fly   159 LKSIKEFYSL-SRKKMDLNGYNITSGLV--IAGAPRWFSFRDRQNRLILTGYMLRMIVDFT---- 216
            |: |:.|.|: :|.:.|..     :||:  :.|..            .|...|||..::||    
  Fly   193 LR-IQMFRSVYTRPEFDKE-----TGLLTRVTGVD------------FLVAQMLRERLNFTMLLQ 239

  Fly   217 -------------NHFNGSVRLMNVLTVNDGLELLANRTIDFF--PFLIRPLKSFSMSNILYLEN 266
                         ..:||::..:    :.|||::...   .||  .:|::....|:::  :|.:.
  Fly   240 QPEKKYFGERSANGSYNGAIGSI----IKDGLDICLT---GFFVKDYLVQQYMDFTVA--VYDDE 295

  Fly   267 CGLIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYC----------SLALRILSKGQISISAAFL 321
            ..:.||.:..:|..:..:....:|.|:.:::....|          :|.|||:|.|...|....|
  Fly   296 LCIYVPKASRIPQSILPIFAVGYDIWLGFVLTAFACALIWLTLRVINLKLRIVSLGNQHIVGQAL 360

  Fly   322 KVL--------RL-VMYLSGSRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEK 377
            .::        || :.:|..|       ...|:|:..:...| .|...::.:.|::.....||.|
  Fly   361 GIMVDTWVVWVRLNLSHLPAS-------YAERMFIGTLCLVS-VIFGAIFESSLATVYIHPLYYK 417

  Fly   378 QINTWEDLDKS------------DSIWPLIDVDIKTMEKLIPDRTKLLKKIV--PTLEAD----V 424
            .|||.::||:|            |.::         ..:..|....|.||:.  ..|.||    |
  Fly   418 DINTMQELDESGLKVVYKYSSMADDLF---------FSETSPLFASLNKKLSWNRDLRADVIDEV 473

  Fly   425 DTYRRNLNTSCIHSGFFDRIDFALYQQKFLRFPIFRKFPHLLYQQPLQISAAFGRPYLQLFNWFV 489
            ..:|.....|...|...:...|.|. :|....|...|:..:.|..|..      .|:....|..:
  Fly   474 ARFRNKAGVSRYTSLILESSHFTLL-RKIWVVPECPKYYTISYVMPRD------SPWEDAVNALL 531

  Fly   490 RKIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLEVKSN------------DVEYYYLIAGLWF 542
            .:...:|:.:|...|      :...:::..|...||..:.            .:.:|.:|     
  Fly   532 LRFLNAGLIVKWIQD------EKSWVDIKMRSNILEADAESELVRVLTIGDLQLAFYVVI----- 585

  Fly   543 GGLTLATVCFLLE 555
            ||..||.:.||.|
  Fly   586 GGNLLAFLGFLAE 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67bNP_648393.1 None
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 16/95 (17%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 20/104 (19%)
Lig_chan 319..587 CDD:278489 59/303 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.