DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir67c

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_729609.1 Gene:Ir67c FlyBaseID:FBgn0052058 Length:573 Species:Drosophila melanogaster

Alignment Length:576 Identity:180/577 (31%)
Similarity:315/577 (55%) Gaps:43/577 (7%)


  Fly     3 LLYLNTLQSLSLLEGNRLVQTVQELNNIYQTELNVFLEFGNGADILESAQGTFVPTLWIKNPQNQ 67
            |::||.:......|.....:.:.:.|:..|.:||::|:..:    :|...|..|..|::.:..::
  Fly     5 LIFLNIILLSDRSESWSAREVIHQFNHDQQLQLNIYLDCND----VELQIGQEVSNLFVNSTADK 65

  Fly    68 KVMKGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLEVLIFFNGGSYDKLIQIFSRCFNEGF 132
            ..:.|.|:|.:|.|...:|...:|.|..:...||...:|.:|...:    ..:...|.:....||
  Fly    66 MKILGRFSSHSLIIACFKDSTRNRTLNGVKELLWGLQYLPILFVVD----SNMDFYFQQALRHGF 126

  Fly   133 VNVLVMLPGSDELYTFMPYQDLKILNLKSIKEFYSLSRKKMDLNGYNITSGLVIAGAPRWFSFRD 197
            ::||.:...:..|||:.||..:::..:|.:::||.|: |..:|.|..:.: .|....||.|.:|:
  Fly   127 IHVLALNFMNGSLYTYKPYPKVEVHQIKDMQKFYKLT-KLRNLQGQAVRT-TVETMTPRCFRYRN 189

  Fly   198 RQNRLILTGYMLRMIVDFTNHFNGSVRLM--NVLTV--NDGLELLANRTIDFFPFLIRPLK--SF 256
            |..:|:..|||.||:.:|.:.:||:...:  ||.||  .:||..|.|..||..|.:|..|:  .|
  Fly   190 RHGQLVYAGYMYRMVKEFISTYNGTEEHVFGNVDTVPYKEGLAALKNGEIDMMPRIIHALEWYYF 254

  Fly   257 SMSNILYLENCGLIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLA---LRILSKGQISISA 318
            ..|:|||.....::||.:.|||..:|.::|:....||..::..:|.|:.   :|...:|..|::.
  Fly   255 YRSHILYNIKTYIMVPWAEPLPKSLYFIQPFRGTVWITIMVSFVYASIVIWWIRYRQQGNSSLTQ 319

  Fly   319 AFLKVLRLVMYLSGSR----DMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQI 379
            :|:.||:|:..|..|:    :||    |.::..|::|...||:|||||.|||||....||::.||
  Fly   320 SFMDVLQLLFQLPLSKIWHFNMG----THQVVSFIVLFVFGFMLTNLYTAQLSSYLTTGLFKSQI 380

  Fly   380 NTWEDL--DKSDSIWPLIDVDI---KTMEKLIPDRTKLLKKIVPTLEADVDTYRRNLNTSCIHSG 439
            ||::||  :|...:....|.::   .|.||:|....:.:  |:.|...:|..:|::||||..:..
  Fly   381 NTFDDLFREKRTLLVESFDAEVLHNMTKEKIIQKEFESI--ILITSIEEVFKHRKSLNTSYAYEA 443

  Fly   440 FFDRIDFALYQQKFLRFPIFRKFPHLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDD 504
            :.|||.|.|.||::||.|||:....:..|:|:.::...|.||::|||.::|:||||||::|:::|
  Fly   444 YEDRIAFELSQQRYLRVPIFKILKEVYDQRPVFVALRHGLPYVELFNNYLRRIFESGIWIKLQED 508

  Fly   505 AYRHGIQSGLLNLAFR-DRHLEVKSNDVEYY---YLIAGLWFGGLTLATVCFLLEL 556
            ::..||.||  .::|| .:..|:|..|.::|   |::.|:   |..::|:...|||
  Fly   509 SFLEGIASG--EISFRKSKSREIKIFDKDFYFFAYILLGM---GWCVSTIALFLEL 559

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67bNP_648393.1 None
Ir67cNP_729609.1 Lig_chan 288..500 CDD:278489 77/218 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131158549
eggNOG 1 0.900 E1_2EU64
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.