| Sequence 1: | NP_648393.1 | Gene: | Ir67b / 39194 | FlyBaseID: | FBgn0036083 | Length: | 574 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001245572.1 | Gene: | Ir7c / 31692 | FlyBaseID: | FBgn0029966 | Length: | 625 | Species: | Drosophila melanogaster |
| Alignment Length: | 583 | Identity: | 125/583 - (21%) |
|---|---|---|---|
| Similarity: | 203/583 - (34%) | Gaps: | 189/583 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 96 LANW----LWEYHHLEVLIFFNGGSY------------------DKLIQIFSRCFNEGFVNVLVM 138
Fly 139 L--PGSDELYTFMPYQDLKILNLKSIKEFYSLSRKKMDL----NGYNITSGL------------- 184
Fly 185 VIAGAPRWFSFRDRQNRLI--------------LTGYMLRMIVDFTNHFNGSVRLMNVLTVNDGL 235
Fly 236 ELL----------------ANRTIDFFPF------LIRPLKSF-SMSNILYLENCGLIVPTSRPL 277
Fly 278 PNWVYLLRPYAFDTWIAWLIMLIY-----CSLALRIL---------SKGQISISAAFLKVLRLVM 328
Fly 329 YLSGSRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIWP 393
Fly 394 LIDVDIKTME-KLIPDRTKLLKKIVPT------LEADVDTYRRNLNTSCIHSGFFDRIDFALYQQ 451
Fly 452 KFLRFPIFRKFP---HL------LYQQPLQISAAFGRPYLQLFNWFVRKI-------FESGI--- 497
Fly 498 YLKMKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVEYYYLIAGLWF--GGLTL-ATVCFLLELL 557 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ir67b | NP_648393.1 | None | |||
| Ir7c | NP_001245572.1 | Lig_chan-Glu_bd | 225..287 | CDD:214911 | 9/65 (14%) |
| Lig_chan | 343..593 | CDD:278489 | 59/295 (20%) | ||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR42643 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||