DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67b and Ir7c

DIOPT Version :8

Sequence 1:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster

Alignment Length:583 Identity:125/584 (21%)
Similarity:203/584 (35%) Gaps:189/584 (32%)


  Fly    96 LANW----LWEYHHLEVLIFFNGGSY------------------DKLIQIFSRCFNEGFVNVLVM 138
            :|.|    |..|..||:.:...|..|                  :.|..:|.|..|...:||.|.
  Fly    92 IAIWFLDSLRSYFRLEMYLNQLGSPYKRNGFFLVIYTGLEDQPMESLKIMFRRLLNMYVLNVNVF 156

  Fly   139 L--PGSDELYTFMPYQDLKILNLKSIKEFYSLSRKKMDL----NGYNITSGL------------- 184
            |  .|:..|||:.||......:  |:..:|:..:   ||    ||:.:|..|             
  Fly   157 LQRDGTVHLYTYYPYGPHHCQS--SLPVYYTAFQ---DLAAPANGFGLTKPLFPRKLTNMHGCEM 216

  Fly   185 VIAGAPRWFSFRDRQNRLI--------------LTGYMLRMIVDFTNHFNGSVRLMNVLTVNDGL 235
            |:|      :|..|...:|              :.|.:.|.:.:   ..|.:::|:.....|.| 
  Fly   217 VVA------TFEHRPYVIIEDDPKTPGGRSIHGIEGLIFRSLAE---RMNFTIKLVEQKDKNRG- 271

  Fly   236 ELL----------------ANRTIDFFPF------LIRPLKSF-SMSNILYLENCGLIVPTSRPL 277
            |:|                .|.|...|.:      |:.|..|: |...:|.:.:.|.|.|..|  
  Fly   272 EILPDGNFTGILKMMVDGEVNLTFVCFMYSKARSDLMLPSTSYTSFPIVLVVPSGGSISPMGR-- 334

  Fly   278 PNWVYLLRPYAFDTWIAWLIMLIY-----CSLALRIL---------SKGQISISAAFLKVLRLVM 328
                 |.||:.:..|...|:.||:     |.|.:..|         .:.::.....:..:|..:.
  Fly   335 -----LTRPFRYIIWSCILVSLIFGFVLICLLKITALPGLRNLVLGRRNRLPFMGMWASLLGGLA 394

  Fly   329 YLSGSRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIWP 393
            ..:..|:.     .|.:.:..:|.|  .||...|..||            ....:|::....|..
  Fly   395 LYNPQRNF-----ARYILVMWLLQT--LILRAAYTGQL------------YLLLQDVEMRSPIKS 440

  Fly   394 LIDVDIKTME-KLIPDRTKLLKKIVPT------LEADVDTYRRNLNTSCIHSGFFDRIDFALYQQ 451
            |.:|..|..| :::|....:.|..:||      |..:...||       :.......|..||.|.
  Fly   441 LSEVLAKDYEFRILPALRTIFKDSMPTTNFHAVLSLEESLYR-------LRDEDDPGITVALLQP 498

  Fly   452 KFLRFPIFRKFP---HL------LYQQPLQISAAFGRPYLQLFNWFVRKI-------FESGI--- 497
            ...:|. ||..|   ||      |...||..       |::..::|.|:|       ..|||   
  Fly   499 TVNQFD-FRSGPNKRHLTVLPDPLMTAPLTF-------YMRPHSYFKRRIDRLIMAMMSSGIVAR 555

  Fly   498 YLKMKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVEYYYLIAGLWF--GGLTL-ATVCFLLELL 557
            |.||..|..:.         ..:.|:||.|...:   :.::|::.  .||.| |.:.|:||:|
  Fly   556 YRKMYMDRIKR---------VSKRRNLEPKPLSI---WRLSGIFVCCAGLYLVALIVFILEIL 606

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67bNP_648393.1 None
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 9/66 (14%)
Lig_chan 343..593 CDD:278489 60/296 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.