| Sequence 1: | NP_648393.1 | Gene: | Ir67b / 39194 | FlyBaseID: | FBgn0036083 | Length: | 574 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_572406.1 | Gene: | Ir7a / 31686 | FlyBaseID: | FBgn0029961 | Length: | 614 | Species: | Drosophila melanogaster | 
| Alignment Length: | 662 | Identity: | 128/662 - (19%) | 
|---|---|---|---|
| Similarity: | 224/662 - (33%) | Gaps: | 199/662 - (30%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     1 MELLYLNTLQSLSLLEGNRLVQTVQELNNIYQTELNVFLEFGNGADILESAQ-------GTFVPT 58 
  Fly    59 LWIKNPQNQKVMKGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLEVLIFFNGGSYDKLIQI 123 
  Fly   124 ---FSR-CFNEGFVNVLVMLPGSDELYTFMPYQ------DLKILNLKSIKEFY--SLSRKKMDLN 176 
  Fly   177 GYNITSGLVIAGAPRWFSFRDRQNRLILTGYMLRMIVDFTNHFNGSVRLMNV--LTVNDG--LEL 237 
  Fly   238 LANRTIDFFPFLIRPLKS--------------------------------------FSMSNILYL 264 
  Fly   265 ENCGLIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRILSK---GQISISAAFLKVLRL 326 
  Fly   327 VMYLSGSRDMGTRPTTRRL------FLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDL 385 
  Fly   386 DKSDSIWPLIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTYRRNLNTSCIHSGFFDRIDFAL-- 448 
  Fly   449 -YQQKFLRFPIF-------------RKFPHL-----LYQQPLQ------ISAAFGRPYLQLFN-- 486 
  Fly   487 ---WFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVEYY---YLIAGLWFGGL 545 
  Fly   546 TLATVCFLLELL 557  | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR42643 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||