DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir7a

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster

Alignment Length:662 Identity:128/663 (19%)
Similarity:224/663 (34%) Gaps:199/663 (30%)


  Fly     1 MELLYLNTLQSLSLLEGNRLVQTVQELNNIYQTELNVFLEFGNGADILESAQ-------GTFVPT 58
            :|:|......|.|.|....|.|..:..:...:..:.:.|........|.:.|       .:||..
  Fly    35 LEILAEQVSPSQSTLAVMDLTQDAEHRDERQEQLMTIILRSVGSEMALRTFQKPPAEVPASFVVF 99

  Fly    59 LWIKNPQNQKVMKGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLEVLIFFNGGSYDKLIQI 123
            | :.:.|....:..:||          |.|..|...:|           :|:.....|..:.:|:
  Fly   100 L-VNSAQAFNTLGFHFT----------DIHSTREFNFL-----------ILLTHRMSSRAERLQV 142

  Fly   124 ---FSR-CFNEGFVNVLVMLPGSDELYTFMPYQ------DLKILNLKSIKEFY--SLSRKKMDLN 176
               .|| |......||:::....|.:.....|:      ||.: ||:.| :.|  .|.|...:..
  Fly   143 LRDISRTCVRFHTSNVILLTEKRDGVVLVYAYRLLNMDCDLSV-NLELI-DIYKNGLFRHGHEAR 205

  Fly   177 GYNITSGLVIAGAPRWFSFRDRQNRLILTGYMLRMIVDFTNHFNGSVRLMNV--LTVNDG--LEL 237
            .:|..  |.::|.|           |.::.|.|...|.|..:.:.......:  ||..||  ::|
  Fly   206 SFNRV--LSLSGCP-----------LQVSWYPLPPFVSFIGNSSDPEERAQIWRLTGIDGELIKL 257

  Fly   238 LANRTIDFFPFLIRPLKS--------------------------------------FSMSNILYL 264
            ||: ..||...|..|...                                      ||.::..:.
  Fly   258 LAS-IFDFRILLEEPCNKCLSPDIKDDCSGCFDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQ 321

  Fly   265 ENCGLIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRILSK---GQISISAAFLKVLRL 326
            .:...|:..|........|..|:....|:|.::..:...|.|.:.::   |:..:::..|:||..
  Fly   322 SSLVFIMHMSSQFGAVAQLAVPFTVIVWLALVVSSLLLVLVLWMRNRLVCGRSDLASHALQVLTT 386

  Fly   327 VMYLSGSRDMGTRPTTRRL------FLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDL 385
            :|  ....:..:.|.:.||      :|.::|     :|..:|..:| .:|....|.|.:.|    
  Fly   387 LM--GNPLEARSLPRSSRLRILYAGWLLLVL-----VLRVVYQGKL-FDSFRLPYHKPLPT---- 439

  Fly   386 DKSDSIWPLIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTYRRNLNTSCIHSGFFDRIDFAL-- 448
                           .:.:||.....|:.      :..:|.|.|.| |....:|..||.|:..  
  Fly   440 ---------------EISELIRSNYTLIN------QEYLDYYPREL-TVLTRNGSKDRFDYIQGL 482

  Fly   449 -YQQKFLRFPIF-------------RKFPHL-----LYQQPLQ------ISAAFGRPYLQLFN-- 486
             .:.||....:.             .:..|:     |||..:.      :..||.|...||.:  
  Fly   483 GKEGKFTTTSLIATMEYYNMMHWSTSRLTHIKEHIFLYQMVIYLRRHSLLKFAFDRKIKQLLSAG 547

  Fly   487 ---WFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVEYY---YLIAGLWFGGL 545
               :|||: |::..|.|..::.|                  ||....::.:   |.|:.:|   |
  Fly   548 IIGYFVRE-FDACQYRKPFEEDY------------------EVTPIPLDSFCGLYYISLIW---L 590

  Fly   546 TLATVCFLLELL 557
            :.|.|.|:||||
  Fly   591 SAAVVAFILELL 602



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.