DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir41a

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_995744.4 Gene:Ir41a FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster

Alignment Length:511 Identity:99/512 (19%)
Similarity:179/512 (35%) Gaps:153/512 (30%)


  Fly   132 FVNVLVMLPGSDEL---YTFMPYQDLKILNLKSIKEFYSLSRKKMDLNGYNITSGLVIAGAPRWF 193
            |.:.|..|.|.:.:   :.:.||..:|          :::|....|:.         ::|.    
  Fly   201 FADKLNNLQGREVIIAGFDYPPYTVIK----------HNMSTNAQDMG---------VSGE---- 242

  Fly   194 SFRDRQNRLILTGYMLRMIVDFTNHFNGSVRLMNVLTVND------------GLELLANRTIDF- 245
              .|.:| :.:.|...|::::|...||.:::: :....||            .|.:|.||..|. 
  Fly   243 --SDFKN-VYIDGTETRIVLNFCEQFNCTIQI-DSSAANDWGKVYPNMSGDGALGMLINRKADIC 303

  Fly   246 ----------FPFLIRPLKSFSMSNILYLENCGL--IVPTSRPLPNWVYLLRPYAFDTWIAWLIM 298
                      :.:|     ..||    ||...|:  :||....|.:|...|.|:....|.|  |:
  Fly   304 IGAMYSWYEDYTYL-----DLSM----YLVRSGITCLVPAPLRLTSWYLPLEPFKETLWAA--IL 357

  Fly   299 LIYCS----LALRILSKGQISI----------SAAFLKVLRLVMYLSGSRDMGTRPTTRRLFLFV 349
            |..|:    |.|...|:..:.:          ..:|.......:::|.|.:......|.|:.||.
  Fly   358 LCLCAEATGLVLAYKSEQALYVLPGYREGWWTCTSFGVCTTFKLFISQSGNSKAYSLTVRVLLFA 422

  Fly   350 ILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDK-SDSIWPL--------------IDVDI 399
            .. .:..|:|::|...|:|          |.|...:|: :|::..|              :....
  Fly   423 CF-LNDLIITSIYGGGLAS----------ILTIPSMDEAADTVTRLRFHRLQWAANSEAWVSAIR 476

  Fly   400 KTMEKLIPDRTKLLKKIVPTLEADVDTYRRNLNTSCIHSGF-FDRIDF------------ALYQQ 451
            .:.|.|:.|   :|...  .:.:| |...|......:..|| .:|:.|            |:.|.
  Fly   477 ASDEALVKD---ILYNF--HIYSD-DELLRLAQDQHMRIGFTVERLPFGHFAIGNYLGPQAIDQL 535

  Fly   452 KFLRFPIFRKFPHLLYQQPLQISAAFGR---PYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSG 513
            ..::..|:           .|.:.||..   |.|...|..:.....||.     |..:.:.:.:.
  Fly   536 VIMKDDIY-----------FQYTVAFVPRLWPLLDKLNTLIYSWHSSGF-----DKYWEYRVVAD 584

  Fly   514 LLNLAFRDRHLEVKSNDVEYYYLIAGL---------WFGGLTLATVCFLLELLIGY 560
            .|||..:.:..|..:...:...:..|:         |..|..:||:.|||||.:.|
  Fly   585 NLNLKIQQQVQETMTGTKDIGPVPLGMSNFAGFIIVWILGSAIATLTFLLELSLTY 640



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.