DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir52b

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_725469.2 Gene:Ir52b FlyBaseID:FBgn0050469 Length:596 Species:Drosophila melanogaster

Alignment Length:608 Identity:125/609 (21%)
Similarity:234/609 (38%) Gaps:98/609 (16%)


  Fly     8 TLQSLSLLEGNRLVQTVQELNN--IYQTELNVFLEFGNGADILESAQGTFVPTLWIKNPQNQKVM 70
            ::|:.||:: |.|:..:.:|.|  .|.|    .|.:|...:.....:...|..:.:.:..|   .
  Fly    22 SVQNQSLMD-NELINLLLKLRNEEFYDT----LLVYGKDCEFHSVIKNVDVAVVLVSDSMN---F 78

  Fly    71 KGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLEVLI--FFNGGS----YDKLIQIFSRCFN 129
            :.||:|.||.:....|  :|.|.....:...:.:...||:  .|...:    |.:..|.......
  Fly    79 EWNFSSLTLILSCGPD--IDNGGPNSTSIKLQRNRRLVLLKEDFQPSNICNIYTQKEQYNIALVR 141

  Fly   130 EGFVNVLVMLPGSDELYTFMPYQDLKI--LNLKSIKEFYSLSRKKMDLNGYNITSGLVIAGAPRW 192
            |.|..       |..:||...:||..:  :||...|..:....:.|......|...|:   .||.
  Fly   142 ENFTK-------SKSIYTCRYFQDPNVDEVNLSGTKPIFIEQFQNMKGKAIRIVPDLL---PPRV 196

  Fly   193 FSFRD-RQNRLILTGYMLRMIVDFTNHFNGSVRL-----------MNVLTVNDGLEL-------- 237
            ..::| ....|.:.||:..:|.:|....|.:::|           ::.:..:|.|::        
  Fly   197 MLYQDANDGELKMIGYVANLITNFAQKVNATLQLDFLKPSTSITEISRMAKDDELDMGITLEASL 261

  Fly   238 -LANRTIDFFPFLIRPLKSFSMSNILYLENCGLI-VPTSRPLPNWVYLLRPYAFDTWIAWLIMLI 300
             .:|.....:|:|   |.|:          |.:: ||...|. |.||.|   ..|..:..:|.::
  Fly   262 NTSNLETSSYPYL---LTSY----------CLMVQVPAKFPY-NLVYAL---IVDPLVLGIIFVL 309

  Fly   301 YCSLALRI-----LSKGQISISAAFLKVLRLVMYLSGSRDMGTRPTTRRLFLFVILTTSGFILTN 360
            :..|::.:     :|...:|::...|....|...|..|.......:.:...:|.||..:..:||.
  Fly   310 FLLLSVLLIYSQKMSWQDLSVANILLNDKSLRGLLGQSFPFPLNASKKLRLIFTILCFASIMLTT 374

  Fly   361 LYVAQLSSNSAAGLYEKQINTWEDLDKSD--------SIWPLIDVDIKTMEKLIPDRTKLLKKIV 417
            :|.|.|.|.......|.:|.:::|:...:        .:..||..:.....::..|..::...:.
  Fly   375 MYEAYLQSFFTNPPSEPEICSFQDVGSYNRRIAMSALEVNGLIKTNNSHFREIRMDDLEIFDNMP 439

  Fly   418 PTLEADVDTYRRNLNTSCIHSGFFDRIDFALYQQKFLRFPIFRKFPHLLYQQPLQISAAFGR--P 480
            ...|.. |.:  ||:.:.:.:|  ||......||...:.|:|.....|.:.:.:.:|....|  |
  Fly   440 ECYELR-DAF--NLSYNYVVTG--DRWRSYAEQQTLFKEPVFYFARDLCFSRLIFLSVPLRRHLP 499

  Fly   481 YLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHL----EVKSNDVEYYYLIAGLW 541
            |..||:..:.:..|.|........::...::.||.:|....|.|    .:..:|:.:   |..::
  Fly   500 YRHLFDEHMMQQHEFGFVNYWMSHSFFDMVRLGLTSLKDLSRPLAYTPSLLMDDISW---IMKIY 561

  Fly   542 FGGLTLATVCFLLELLIGYAKIK 564
            ...:.|...|||||  ||..|.|
  Fly   562 LAAIVLCVFCFLLE--IGVDKWK 582



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.