DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir52c

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_725470.1 Gene:Ir52c FlyBaseID:FBgn0050468 Length:599 Species:Drosophila melanogaster

Alignment Length:626 Identity:120/627 (19%)
Similarity:238/627 (38%) Gaps:145/627 (23%)


  Fly    19 RLVQTVQELNNIYQTELNVFLEFGNGADILESAQGTFVPTLWIKNPQNQKVMKGNFTSCTLTI-L 82
            ||...:|.|.  .:...:..|.:|....|....:...||.:.:.:....  ...||:|.||.: .
  Fly    32 RLFGLLQRLQ--VEKSYDTLLVYGEDCAIPSLFERLQVPAVLVSSGSTN--FDWNFSSLTLILSC 92

  Fly    83 YLEDEHLDRGLYYLANW--LWEYHHLEVLIFFNG--------GSYDKLIQIFSRCFNEGFVNVLV 137
            ..:||..:       |:  |.:......||...|        ..|.|..|.......|.|..:.|
  Fly    93 NFQDEREE-------NYRTLMKLQTSRRLILLKGHIKPESVCDFYSKKEQHNVAMVKENFYQLEV 150

  Fly   138 MLPGSDELYTFMPYQDLKILNLKSI-KEFYSLSRKKMDLNGYNITSGLVIAGAPRWFSFRD-RQN 200
            :.  |..|:....|:.|.:.:.||| |:.:      .:::|..|.: |.....||...:.| :..
  Fly   151 VY--SCRLFQDQNYEKLNLFDGKSIYKDQF------RNMHGAPIRT-LSDKEPPRTIPYIDSKTG 206

  Fly   201 RLILTGYMLRMIVDFTNHFNGSVRLMNVLTVNDGLELLANRTIDFFPFLIRPLKSFSMSNILYLE 265
            .....||:..:|..|....|.::::...|..:|       ..:.|.     .:.:|:.::||.:.
  Fly   207 EEKFKGYVGMLISQFVKKVNATMQIREDLIKDD-------EEVSFV-----DITNFTSNDILDIG 259

  Fly   266 NCGLIVPTSRPLP-------NWVYLLRPYAF-----------DTWIA-------WLIMLIYCSLA 305
            .|     .:|.|.       ::.||:..|.|           |.::|       .:.::|:|..:
  Fly   260 IC-----EARTLEMSNYDAISYPYLMSSYCFMAPLPDSLPFSDVYMAIVAPSILIMFLIIFCICS 319

  Fly   306 LRIL-----SKGQISISAAFLKVLRLVMYLSGSRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQ 365
            :.|:     |...::|.:..:..:.|..:|:.......:...:...:|:::..|..|.|.:|.|.
  Fly   320 VLIIYIQERSYRSLTIRSVLMNDICLRGFLAQPFPFPRQYNRKLKLIFMLVCFSSLISTTMYTAY 384

  Fly   366 LSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTY--- 427
            |.:.......|.::.:::|:.||.          .||...|.:| :.|:.:..:|| ||:.|   
  Fly   385 LQAFLWGPPIEPRLTSFDDVKKSR----------YTMAINIYER-EFLEALNVSLE-DVEIYDYG 437

  Fly   428 -----RRNLNTSCI-------------------HSGFFDRIDFALYQQKFLRFPIFRKFPHL-LY 467
                 |...||:.:                   :..|:....|.|.|...|..|:.|..|:. ::
  Fly   438 KFSKLRSTFNTNYLFPVTALQWFTINEEQKLFKYKIFYYCDAFCLNQFDILSIPLRRHLPYRDIF 502

  Fly   468 QQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVE 532
            ::.:.:...||     |..:::             |.:||..|::.|  ..|:|....::::.:|
  Fly   503 EEHMLLQKEFG-----LTKYWI-------------DQSYRDMIRANL--TTFKDFSPLLENDYIE 547

  Fly   533 YY--YLIAGLWFGGLTLATVCFLLELLIGYAKIKVTISCKM 571
            .:  |.:..::|.|:.:....|:||:|   ..::...:||:
  Fly   548 VHNLYWVFTMYFVGMGMGLCFFILEIL---RPLRYWRNCKI 585



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.