DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir51b

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_725440.1 Gene:Ir51b FlyBaseID:FBgn0050081 Length:597 Species:Drosophila melanogaster

Alignment Length:587 Identity:137/588 (23%)
Similarity:250/588 (43%) Gaps:105/588 (18%)


  Fly    18 NRLVQTVQELNNIYQTELNVFLEFGNGADILESAQGTFVPTLWIKNPQNQKVMKGNFTSCT---L 79
            |.|:..:.:...:....:|:||:                       |::.:.: |:|....   :
  Fly    56 NDLIIWLHQTMGVTSLTMNLFLQ-----------------------PEHIRPL-GHFKITRYNGI 96

  Fly    80 TILYLEDEH------LDRGLYYLANWLWEYHHLEVLIFF---NGGSYDKLIQIFSRCFNEGFVNV 135
            .:.:..|:|      |||.|..|       ..:.::|..   ..||...:..||:..:...|:||
  Fly    97 ALFFCHDKHDIMWLTLDRNLRKL-------RRIRLIIILRNQRSGSQGAIKSIFNALWQYQFLNV 154

  Fly   136 LVMLPGSDELYTFMPYQDLKILNLKSIKE--FYSLSRKKMDLNGYNITSGLVIAGAPRWFSFRD- 197
            ||:  ..|:||::.||..::...|....|  |...:|   :.:|| :.|.......||.|...| 
  Fly   155 LVL--QRDQLYSYTPYPAMRFFKLDIHTEPLFPHAAR---NFHGY-VVSTPAENDIPRVFHVHDP 213

  Fly   198 -RQNRLILTGYMLRMIVDFTNHFNGSVRLMN---------VLTVNDGLELL--ANRTIDFFPFLI 250
             .::|.:| ||..|..|::.:|:|.|:||.|         .:.:|..::|:  ....|...|::.
  Fly   214 LTKSRKVL-GYAYRTFVEYLDHYNASLRLTNPDENLDPTTSVNMNHIVQLIIDGQLEISLHPYVF 277

  Fly   251 RPLKSFSMSNILYLENCGLIVPTSRPLPNWVYLLRPYAFDTW------IAWLIMLIYCSLALRIL 309
            .|..:.....:|...|| ||||....:|..:|||||:...:|      :.::..::||.......
  Fly   278 TPPTATKSYPLLIYPNC-LIVPMRNEIPRHMYLLRPFQLYSWYILLFAVFYITGILYCISPKLNK 341

  Fly   310 SKGQISISAAFLKVLRLVMYLSGSRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGL 374
            |.....:...||..:..::::|....: .|||.|.|.:|:.|:..||:.|:.|..:|.|.....:
  Fly   342 SSWPQRLGLNFLDAISKILFISPPITI-YRPTWRHLIIFLQLSVLGFMSTSWYNIELDSFFTTIV 405

  Fly   375 YEKQINTWEDLDKSDSIWPLIDVDIKTMEKLIPDR--TKLLKKIVPTLEADVDTYRRNLNTSCIH 437
            ..:|:|:.:.|........:.:.:|.|..:.:..|  .|:.:.:||...::..:...:.|.|..:
  Fly   406 VGEQVNSMDQLVHQQQRVLVKEYEINTFLRHVEPRLVEKVSRLLVPVNASEQVSALLSFNRSFAY 470

  Fly   438 SGFFDRIDFALYQQKFLRFPIFR------KFPHLLYQQPLQISAAFGRPYLQL-FNWFVRKIFES 495
            ....:|..|...||::...||||      ..||:.|  |:::.:     :|:. .|.|:.||.::
  Fly   471 PFTEERWQFFAMQQQYAFKPIFRFSSACLGSPHIGY--PMRVDS-----HLETSLNHFILKIQDT 528

  Fly   496 GI--YLKMKD--DAYRHGIQSGLLNLAFRDRHLEVKSNDVEYYYL---IAGLWFGGLTLATVCFL 553
            |:  :..:.|  ||.|.|.      :.|.|..|..:|.||:...|   :.|:   |..|:.:.|.
  Fly   529 GLLNHWVVSDFNDAMRAGY------VRFVDNVLGYQSIDVDTLRLGWCVLGI---GWILSALVFS 584

  Fly   554 LE 555
            .|
  Fly   585 CE 586



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.