DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32055 and EMS1

Sequence 1:NP_729599.1 Gene:CG32055 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_196345.1 Gene:EMS1 AraportID:AT5G07280 Length:1192 Species:Arabidopsis thaliana

Alignment Length:600 Identity:143/600 (24%)
Similarity:218/600 (36%) Gaps:176/600 (29%)


  Fly     6 VLALLLLSGVFGKDLQECEDLGNGSYLCREIESFEQLNRYVGKNWK---SVKVVNEHTGIE---R 64
            :|:...|||....:|.|...|   ::.....:....|..::|| ||   |:.:.|.....|   .
plant   288 MLSFNSLSGPLPLELSEIPLL---TFSAERNQLSGSLPSWMGK-WKVLDSLLLANNRFSGEIPHE 348

  Fly    65 AED---------------GELP----GLSTLLQLDLSESGGVTLG--EKGLQDFKALQKLNLTHA 108
            .||               |.:|    |..:|..:||  ||.:..|  |:......:|.:|.||:.
plant   349 IEDCPMLKHLSLASNLLSGSIPRELCGSGSLEAIDL--SGNLLSGTIEEVFDGCSSLGELLLTNN 411

  Fly   109 QLD---------------ELKSEQFP--------NPSEMINFDVSYNDILAITTKLMSGFGNLVY 150
            |::               :|.|..|.        ..:.::.|..|||.:.......:....:|..
plant   412 QINGSIPEDLWKLPLMALDLDSNNFTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLKR 476

  Fly   151 ANFSENLIAVIEPNAFRHMKNLRFLDLTTNYQEN---ITLGENANLRFLSISNNNLRDFQWCHLR 212
            ...|:|.:....|.....:.:|..|:|..|..:.   :.||:..:|..|.:.:|||:......:.
plant   477 LVLSDNQLTGEIPREIGKLTSLSVLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKIT 541

  Fly   213 VLPKLEELHLHSN-----------------------WLEHLDMGIFYALPN-------------- 240
            .|.:|:.|.|..|                       :|:|  .|||....|              
plant   542 ALAQLQCLVLSYNNLSGSIPSKPSAYFHQIEMPDLSFLQH--HGIFDLSYNRLSGPIPEELGECL 604

  Fly   241 -LRVLNVSNNNLF-EIKRTLFMAPGEIAPLELLDYSSN-----IVKVLDDSVFCRLKKLRTLNLW 298
             |..:::|||:|. ||..:|    ..:..|.:||.|.|     |.|.:.:|:     ||:.|||.
plant   605 VLVEISLSNNHLSGEIPASL----SRLTNLTILDLSGNALTGSIPKEMGNSL-----KLQGLNLA 660

  Fly   299 LNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQKLGLRVFGERIL 363
            .||:|...|.:|..|.||..|:|..||:.........||..|..:|||.||:.       ||   
plant   661 NNQLNGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLS-------GE--- 715

  Fly   364 RKLIYLDLSNNYIADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEID 428
                   ||:.         ||:|..:..|.:.:|:...........|.||:.|.::||.|   .
plant   716 -------LSSE---------LSTMEKLVGLYIEQNKFTGEIPSELGNLTQLEYLDVSENLL---S 761

  Fly   429 GEILDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNITLEGN-PWQCLCLDEITSWLNGRHVSY 492
            |||             ..::..||:|:    .|.|....|.|. |...:|.|             
plant   762 GEI-------------PTKICGLPNLE----FLNLAKNNLRGEVPSDGVCQD------------- 796

  Fly   493 ARPSSAYFSGRKPLC 507
              ||.|..||.|.||
plant   797 --PSKALLSGNKELC 809

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 7/25 (28%)
leucine-rich repeat 100..123 CDD:275380 8/46 (17%)
LRR_8 128..180 CDD:290566 10/52 (19%)
leucine-rich repeat 128..147 CDD:275380 3/19 (16%)
leucine-rich repeat 148..171 CDD:275380 4/23 (17%)
leucine-rich repeat 172..192 CDD:275380 6/23 (26%)
LRR_RI <187..400 CDD:238064 68/257 (26%)
LRR_8 192..251 CDD:290566 20/97 (21%)
leucine-rich repeat 193..216 CDD:275380 6/23 (26%)
leucine-rich repeat 217..240 CDD:275380 9/46 (20%)
leucine-rich repeat 241..267 CDD:275380 8/27 (30%)
leucine-rich repeat 268..291 CDD:275380 8/28 (29%)
LRR_8 290..350 CDD:290566 25/60 (42%)
leucine-rich repeat 292..315 CDD:275380 10/23 (43%)
leucine-rich repeat 316..339 CDD:275380 7/23 (30%)
LRR_8 340..400 CDD:290566 15/60 (25%)
leucine-rich repeat 340..365 CDD:275380 8/25 (32%)
leucine-rich repeat 366..389 CDD:275380 5/23 (22%)
leucine-rich repeat 390..413 CDD:275380 3/23 (13%)
LRR_8 391..448 CDD:290566 12/57 (21%)
leucine-rich repeat 414..437 CDD:275380 8/23 (35%)
EMS1NP_196345.1 PLN00113 30..1190 CDD:215061 143/600 (24%)
leucine-rich repeat 91..114 CDD:275380
LRR_RI 115..294 CDD:238064 1/6 (17%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..163 CDD:275380
leucine-rich repeat 164..187 CDD:275380
leucine-rich repeat 188..211 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..303 CDD:275380 5/15 (33%)
leucine-rich repeat 333..350 CDD:275380 3/17 (18%)
LRR_RI 345..605 CDD:238064 50/264 (19%)
leucine-rich repeat 355..378 CDD:275380 3/23 (13%)
leucine-rich repeat 379..402 CDD:275380 7/25 (28%)
leucine-rich repeat 403..424 CDD:275380 5/21 (24%)
leucine-rich repeat 426..449 CDD:275380 3/23 (13%)
leucine-rich repeat 450..473 CDD:275380 4/23 (17%)
leucine-rich repeat 474..497 CDD:275380 4/23 (17%)
leucine-rich repeat 498..521 CDD:275380 6/23 (26%)
leucine-rich repeat 522..545 CDD:275380 6/23 (26%)
leucine-rich repeat 546..578 CDD:275380 4/32 (13%)
leucine-rich repeat 579..604 CDD:275380 6/27 (22%)
LRR_RI 606..820 CDD:238064 78/274 (28%)
leucine-rich repeat 606..629 CDD:275380 8/27 (30%)
leucine-rich repeat 630..646 CDD:275380 6/16 (38%)
leucine-rich repeat 654..677 CDD:275380 10/23 (43%)
leucine-rich repeat 678..701 CDD:275380 7/23 (30%)
leucine-rich repeat 702..725 CDD:275380 13/49 (27%)
leucine-rich repeat 726..749 CDD:275380 3/23 (13%)
leucine-rich repeat 750..773 CDD:275380 10/39 (26%)
PKc_like 923..1192 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
10.910

Return to query results.
Submit another query.