DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32055 and GHR1

Sequence 1:NP_729599.1 Gene:CG32055 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001320016.1 Gene:GHR1 AraportID:AT4G20940 Length:1037 Species:Arabidopsis thaliana

Alignment Length:444 Identity:114/445 (26%)
Similarity:176/445 (40%) Gaps:111/445 (25%)


  Fly   133 DILAITT----KLMSGFGNLVYANFSENLIAVIEPNAFRHMKNLRFLDLTTN-YQENI--TLGEN 190
            |.|.:|.    .|.|....||..:.|.|.::.:.||.....|:|:||||:.| :..::  .:|.:
plant    61 DNLGLTADADFSLFSNLTKLVKLSMSNNSLSGVLPNDLGSFKSLQFLDLSDNLFSSSLPKEIGRS 125

  Fly   191 ANLRFLSISNNN-----------------------------------LRDFQWCHL--------- 211
            .:||.||:|.||                                   |.|..:.:|         
plant   126 VSLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSNGFTGKM 190

  Fly   212 ----RVLPKLEELHLHSNWLE-HLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELL 271
                .::..||.|.||.|.:: :|| |.|:.|.|...:::|.|.|......|.  ||....::.|
plant   191 PRGFELISSLEVLDLHGNSIDGNLD-GEFFLLTNASYVDISGNRLVTTSGKLL--PGVSESIKHL 252

  Fly   272 DYSSNIVKVLDDSVFCRLKKLRTLNLWLNQI-------NRIHPRAFLGLSS-------------- 315
            :.|.|.::....|.|...:.|:.|:|..|.:       |.::....|.||:              
plant   253 NLSHNQLEGSLTSGFQLFQNLKVLDLSYNMLSGELPGFNYVYDLEVLKLSNNRFSGSLPNNLLKG 317

  Fly   316 ----LQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQ-KLGLRVFGERIL------------ 363
                |.||.|.||.:|.....:.:  |.|..||||.|::. :|.|...|..:|            
plant   318 DSLLLTTLDLSGNNLSGPVSSIMS--TTLHTLDLSSNSLTGELPLLTGGCVLLDLSNNQFEGNLT 380

  Fly   364 -----RKLIYLDLSNNYIADLHPLALSSMPFIKELRLRRNRLV-SLDLRMFAPLRQLQLLTINEN 422
                 ..:.|||||.|:.....|.|...:.....|.|..|:|. ||..|:.....:|::|.|:.|
plant   381 RWSKWENIEYLDLSQNHFTGSFPDATPQLLRANHLNLSYNKLTGSLPERIPTHYPKLRVLDISSN 445

  Fly   423 RLE-EIDGEILDTLDRLNHLELNNNRLTF----LPDLKSSQNLLQLRNITLEGN 471
            .|| .|.|.:| ::..|..:.|.||.:|.    ||...|...||.|.:...:|:
plant   446 SLEGPIPGALL-SMPTLEEIHLQNNGMTGNIGPLPSSGSRIRLLDLSHNRFDGD 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566 17/51 (33%)
leucine-rich repeat 128..147 CDD:275380 5/18 (28%)
leucine-rich repeat 148..171 CDD:275380 7/23 (30%)
leucine-rich repeat 172..192 CDD:275380 7/23 (30%)
LRR_RI <187..400 CDD:238064 71/305 (23%)
LRR_8 192..251 CDD:290566 24/108 (22%)
leucine-rich repeat 193..216 CDD:275380 10/71 (14%)
leucine-rich repeat 217..240 CDD:275380 11/24 (46%)
leucine-rich repeat 241..267 CDD:275380 6/26 (23%)
leucine-rich repeat 268..291 CDD:275380 5/23 (22%)
LRR_8 290..350 CDD:290566 22/85 (26%)
leucine-rich repeat 292..315 CDD:275380 8/30 (27%)
leucine-rich repeat 316..339 CDD:275380 8/23 (35%)
LRR_8 340..400 CDD:290566 21/78 (27%)
leucine-rich repeat 340..365 CDD:275380 10/43 (23%)
leucine-rich repeat 366..389 CDD:275380 8/23 (35%)
leucine-rich repeat 390..413 CDD:275380 7/24 (29%)
LRR_8 391..448 CDD:290566 20/59 (34%)
leucine-rich repeat 414..437 CDD:275380 9/24 (38%)
GHR1NP_001320016.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.