DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32055 and RLP38

Sequence 1:NP_729599.1 Gene:CG32055 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_188953.1 Gene:RLP38 AraportID:AT3G23120 Length:784 Species:Arabidopsis thaliana

Alignment Length:465 Identity:116/466 (25%)
Similarity:186/466 (40%) Gaps:67/466 (14%)


  Fly    69 ELPGLSTLLQ------LDLSESGGVT----LGE-------------KGLQDFKALQKL-NLTHAQ 109
            |.|..|.:||      :|....||||    |||             ..|:...||.|| :|||..
plant    52 EFPIPSVILQNPWNKGIDCCSWGGVTCDAILGEVISLKLYFLSTASTSLKSSSALFKLQHLTHLD 116

  Fly   110 LD--ELKSE---QFPNPSEMINFDVSYNDILAITTKLMSGFGNLVYANFSENLIAVIEPNAFRHM 169
            |.  .|:.|   ...|.|.:.:.|:|.|.::......:.....|.|.:...|.:....|.:|.::
plant   117 LSNCNLQGEIPSSIENLSHLTHLDLSTNHLVGEVPASIGNLNQLEYIDLRGNHLRGNIPTSFANL 181

  Fly   170 KNLRFLDLTTNYQENIT-----LGENANLRFLSISNNNLRDFQWCHLRVLPKLEELHLHSNWLEH 229
            ..|..|||   ::.|.|     |....:|..|.:|:|:.:.|....|..|..||::..:.|..  
plant   182 TKLSLLDL---HENNFTGGDIVLSNLTSLAILDLSSNHFKSFFSADLSGLHNLEQIFGNENSF-- 241

  Fly   230 LDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAP------GEIAPLELLDYSSN--IVKVLDDSVF 286
              :|:|.|    .:|.:|:.:..::.:..|..|      ...:.|.:||.|.|  |.:|  .|..
plant   242 --VGLFPA----SLLKISSLDKIQLSQNQFEGPIDFGNTSSSSRLTMLDISHNNFIGRV--PSSL 298

  Fly   287 CRLKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQ 351
            .:|..|..|:|..|....:.||:...|.:|.:|.:..||:...........:.|:.:|||.|:..
plant   299 SKLVNLELLDLSHNNFRGLSPRSISKLVNLTSLDISYNKLEGQVPYFIWKPSNLQSVDLSHNSFF 363

  Fly   352 KLGLRVFGERILR--KLIYLDLSNNYIADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQL 414
            .||..|   .::.  ||:.|:|.:|.:....|..:.:..|:..|.|..||......:........
plant   364 DLGKSV---EVVNGAKLVGLNLGSNSLQGPIPQWICNFRFVFFLDLSDNRFTGSIPQCLKNSTDF 425

  Fly   415 QLLTINENRLEEIDGEILDTLDRLNHLELN-NNRLTFLPDLKSSQNLLQLRNITLEGNPWQCLCL 478
            ..|.:..|.|.....|:......|..|::: ||.:..||  ||..|...:..:.:.||..:    
plant   426 NTLNLRNNSLSGFLPELCMDSTMLRSLDVSYNNFVGKLP--KSLMNCQDMEFLNVRGNKIK---- 484

  Fly   479 DEITSWLNGR 488
            |....||..|
plant   485 DTFPFWLGSR 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 11/46 (24%)
leucine-rich repeat 100..123 CDD:275380 11/29 (38%)
LRR_8 128..180 CDD:290566 12/52 (23%)
leucine-rich repeat 128..147 CDD:275380 3/19 (16%)
leucine-rich repeat 148..171 CDD:275380 5/23 (22%)
leucine-rich repeat 172..192 CDD:275380 7/25 (28%)
LRR_RI <187..400 CDD:238064 57/223 (26%)
LRR_8 192..251 CDD:290566 15/59 (25%)
leucine-rich repeat 193..216 CDD:275380 7/23 (30%)
leucine-rich repeat 217..240 CDD:275380 6/23 (26%)
leucine-rich repeat 241..267 CDD:275380 4/32 (13%)
leucine-rich repeat 268..291 CDD:275380 9/25 (36%)
LRR_8 290..350 CDD:290566 16/60 (27%)
leucine-rich repeat 292..315 CDD:275380 7/23 (30%)
leucine-rich repeat 316..339 CDD:275380 4/23 (17%)
LRR_8 340..400 CDD:290566 19/62 (31%)
leucine-rich repeat 340..365 CDD:275380 8/27 (30%)
leucine-rich repeat 366..389 CDD:275380 5/23 (22%)
leucine-rich repeat 390..413 CDD:275380 4/23 (17%)
LRR_8 391..448 CDD:290566 12/58 (21%)
leucine-rich repeat 414..437 CDD:275380 4/23 (17%)
RLP38NP_188953.1 PLN00113 11..>721 CDD:331614 116/466 (25%)
leucine-rich repeat 112..135 CDD:275380 8/23 (35%)
leucine-rich repeat 136..159 CDD:275380 3/23 (13%)
leucine-rich repeat 160..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..206 CDD:275380 7/25 (28%)
leucine-rich repeat 207..254 CDD:275380 15/55 (27%)
leucine-rich repeat 255..276 CDD:275380 2/21 (10%)
leucine-rich repeat 280..303 CDD:275380 9/25 (36%)
leucine-rich repeat 304..327 CDD:275380 7/23 (30%)
leucine-rich repeat 352..376 CDD:275380 8/27 (30%)
leucine-rich repeat 377..397 CDD:275380 5/20 (25%)
leucine-rich repeat 401..424 CDD:275380 4/23 (17%)
leucine-rich repeat 425..448 CDD:275380 4/23 (17%)
leucine-rich repeat 449..472 CDD:275380 9/25 (36%)
leucine-rich repeat 473..496 CDD:275380 6/27 (22%)
leucine-rich repeat 523..545 CDD:275380
leucine-rich repeat 659..682 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.