DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32055 and AT2G25790

Sequence 1:NP_729599.1 Gene:CG32055 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_180150.1 Gene:AT2G25790 AraportID:AT2G25790 Length:960 Species:Arabidopsis thaliana

Alignment Length:469 Identity:131/470 (28%)
Similarity:193/470 (41%) Gaps:101/470 (21%)


  Fly    68 GELP----GLSTLLQLDL---SESGGVTLGEKGLQDFKALQKLNLTHAQLDELKSEQFPNPS--- 122
            ||:|    |||:|..|||   :.||.:   ...|.|.|.|:.:.|...:|    |.|.| ||   
plant   231 GEIPYQIGGLSSLNHLDLVYNNLSGPI---PPSLGDLKKLEYMFLYQNKL----SGQIP-PSIFS 287

  Fly   123 --EMINFDVSYNDILAITTKLMSGFGNL-VYANFSENLIAVIEPNAFRHMKNLRFLDLTTN-YQE 183
              .:|:.|.|.|.:.....:|::...:| :...||.||...| |.....:..|:.|.|.:| :..
plant   288 LQNLISLDFSDNSLSGEIPELVAQMQSLEILHLFSNNLTGKI-PEGVTSLPRLKVLQLWSNRFSG 351

  Fly   184 NI--TLGENANLRFLSISNNNLRDFQWCHLRVLP-------KLEELHLHSNWLEHL---DMGIFY 236
            .|  .||::.||..|.:|.|||..       .||       .|.:|.|.||.|:..   .:|:..
plant   352 GIPANLGKHNNLTVLDLSTNNLTG-------KLPDTLCDSGHLTKLILFSNSLDSQIPPSLGMCQ 409

  Fly   237 ALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLEL---LDYSSNIVKVLDDSVFCRLKKLRTLNLW 298
            :|..:|:    .||.|..|     .|.....|:|   ||.|:|.::             ..:|.|
plant   410 SLERVRL----QNNGFSGK-----LPRGFTKLQLVNFLDLSNNNLQ-------------GNINTW 452

  Fly   299 LNQINRIHPRAFLGLSSLQTLHLQGNK-ISILPDDVFANLTALEKLDLSKNNIQKL---GLRVFG 359
                         .:..|:.|.|..|| ...|||  |:....|:|||||:|.|..:   ||..|.
plant   453 -------------DMPQLEMLDLSVNKFFGELPD--FSRSKRLKKLDLSRNKISGVVPQGLMTFP 502

  Fly   360 ERILRKLIYLDLSNNYIADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRL 424
            |     ::.||||.|.|..:.|..|||...:..|.|..|.........||..:.|..|.::.|:|
plant   503 E-----IMDLDLSENEITGVIPRELSSCKNLVNLDLSHNNFTGEIPSSFAEFQVLSDLDLSCNQL 562

  Fly   425 EEIDGEI---LDTLDRLNHLELNNNRLTFLPDLKSSQNLLQLRNITLEGNPWQCLCLDEITSWLN 486
               .|||   |..::.|..:.:::|.|.  ..|..:...|.:....:|||  ..||.:...|.|.
plant   563 ---SGEIPKNLGNIESLVQVNISHNLLH--GSLPFTGAFLAINATAVEGN--IDLCSENSASGLR 620

  Fly   487 GRHVSYARPSSAYF 500
            ...|...|.:.:::
plant   621 PCKVVRKRSTKSWW 634

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380 9/26 (35%)
leucine-rich repeat 100..123 CDD:275380 8/28 (29%)
LRR_8 128..180 CDD:290566 14/53 (26%)
leucine-rich repeat 128..147 CDD:275380 4/19 (21%)
leucine-rich repeat 148..171 CDD:275380 7/24 (29%)
leucine-rich repeat 172..192 CDD:275380 7/23 (30%)
LRR_RI <187..400 CDD:238064 67/230 (29%)
LRR_8 192..251 CDD:290566 20/69 (29%)
leucine-rich repeat 193..216 CDD:275380 8/30 (27%)
leucine-rich repeat 217..240 CDD:275380 8/26 (31%)
leucine-rich repeat 241..267 CDD:275380 6/26 (23%)
leucine-rich repeat 268..291 CDD:275380 6/26 (23%)
LRR_8 290..350 CDD:290566 18/61 (30%)
leucine-rich repeat 292..315 CDD:275380 2/23 (9%)
leucine-rich repeat 316..339 CDD:275380 9/24 (38%)
LRR_8 340..400 CDD:290566 25/63 (40%)
leucine-rich repeat 340..365 CDD:275380 12/28 (43%)
leucine-rich repeat 366..389 CDD:275380 10/23 (43%)
leucine-rich repeat 390..413 CDD:275380 5/23 (22%)
LRR_8 391..448 CDD:290566 15/60 (25%)
leucine-rich repeat 414..437 CDD:275380 8/26 (31%)
AT2G25790NP_180150.1 PLN00113 12..960 CDD:215061 131/470 (28%)
LRRNT_2 28..69 CDD:285463
LRR_RI <73..160 CDD:238064
leucine-rich repeat 74..98 CDD:275380
leucine-rich repeat 99..124 CDD:275380
leucine-rich repeat 125..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..218 CDD:275380
leucine-rich repeat 219..242 CDD:275380 6/11 (55%)
leucine-rich repeat 243..266 CDD:275380 9/26 (35%)
LRR_RI 246..515 CDD:238064 93/327 (28%)
leucine-rich repeat 267..290 CDD:275380 8/28 (29%)
leucine-rich repeat 291..314 CDD:275380 5/23 (22%)
leucine-rich repeat 315..336 CDD:275380 7/22 (32%)
leucine-rich repeat 339..362 CDD:275380 7/23 (30%)
leucine-rich repeat 363..383 CDD:275380 8/27 (30%)
leucine-rich repeat 387..405 CDD:275380 6/18 (33%)
leucine-rich repeat 411..434 CDD:275380 8/32 (25%)
leucine-rich repeat 435..479 CDD:275380 15/72 (21%)
leucine-rich repeat 480..498 CDD:275380 9/18 (50%)
leucine-rich repeat 504..525 CDD:275380 10/21 (48%)
leucine-rich repeat 528..551 CDD:275380 5/23 (22%)
leucine-rich repeat 552..575 CDD:275380 8/26 (31%)
leucine-rich repeat 576..596 CDD:275380 4/22 (18%)
PKc_like 709..940 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.