DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr21

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster

Alignment Length:298 Identity:107/299 (36%)
Similarity:163/299 (55%) Gaps:68/299 (23%)


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI 117
            ||||.:..:|:|||||.:.:|.||:|:||||||:||||||||:|||...|||:||||.:.|::..
  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115

  Fly   118 DEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVY 182
            .:|:||||:.|.||:|:||||:||.|...|::..::|:                           
  Fly   116 GDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVE--------------------------- 153

  Fly   183 QSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSE 247
                               |..:|||||::|:|.|||:||||:||..|:||..:.|.|.::.::.
  Fly   154 -------------------PITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINY 199

  Fly   248 ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAP 312
            ::..|.:...|.|.:.|.|.|||..|.:..||:|:|.|||....|:.||:|:|:.|.|:|.:   
  Fly   200 DSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQKS--- 261

  Fly   313 AAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSL 350
                               .::.:.:.:|..|:.|.:|
  Fly   262 -------------------HLLVSELLSLCFLQICLNL 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 49/80 (61%)
IG_like 210..297 CDD:214653 36/87 (41%)
IGc2 217..287 CDD:197706 29/70 (41%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 46/78 (59%)
IG_like 71..140 CDD:214653 44/69 (64%)
IG_like 162..249 CDD:214653 36/87 (41%)
IGc2 169..242 CDD:197706 30/73 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124148476
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3730
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.