DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and Kirrel3

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 MGIID:1914953 Length:803 Species:Mus musculus

Alignment Length:399 Identity:91/400 (23%)
Similarity:145/400 (36%) Gaps:116/400 (29%)


  Fly    12 LTGLAVCYQRQSVSNNN----HNNAEAKPTHAPPSHYPHGHKWNE------------PYFDLTMP 60
            |..|:|  :.|.|..:|    |.:|:|.|..........||...|            .||...:.
Mouse   251 LVNLSV--EPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVS 313

  Fly    61 RNITSLVGKS-------AYLGCRVK--------HLGNKTV---AWIRHRDLHILTV--GTYTYTT 105
            ..:|:.:|.:       .|.|.|:.        .||:..|   |||.:..|.|:.:  |:....:
Mouse   314 CEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLS 378

  Fly   106 DQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYN 170
            :::            ||.:|..:|.|||.|.|:.             :|..:.|           
Mouse   379 NEK------------TLTLKSVRQEDAGKYVCRA-------------VVPRVGA----------- 407

  Fly   171 DDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTH 235
                  .|..|..:.|       ||....:..|...|.|     :||   .:.|.|:.:| ||..
Mouse   408 ------GEREVTLTVN-------GPPIISSTQTQHALHG-----EKG---QIKCFIRSTP-PPDR 450

  Fly   236 IFWYHQDKVLSEETSGGRLKFKTIKSEE----TKSILLIYDADLLHSGKYSC-----YPSNTEIA 291
            |.|..::.||...|| ||...:|:.:||    |.:|..|..||.  ...|:|     :.|:|||.
Mouse   451 IAWSWKENVLESGTS-GRYTVETVNTEEGVISTLTISNIVRADF--QTIYNCTAWNSFGSDTEII 512

  Fly   292 SIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQSGG 356
            .::....:.:....::..:.|.||.:       |.|..|......::|.:|.. .|:.....:||
Mouse   513 RLKEQGSEMKSGAGLEAESVPMAVII-------GVAVGAGVAFLVLMATIVAF-CCARSQRSTGG 569

  Fly   357 GGGCPGGGS 365
            ..|..|.|:
Mouse   570 RPGISGRGT 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/100 (23%)
IG_like 210..297 CDD:214653 29/96 (30%)
IGc2 217..287 CDD:197706 25/79 (32%)
Kirrel3XP_006510620.1 Ig 52..143 CDD:299845
IG_like 54..143 CDD:214653
IG_like 156..244 CDD:214653
Ig2_KIRREL3-like 165..246 CDD:143236
Ig_3 254..318 CDD:290638 15/66 (23%)
I-set 335..416 CDD:254352 23/123 (19%)
IGc2 349..400 CDD:197706 17/63 (27%)
Ig5_KIRREL3 418..515 CDD:143306 34/109 (31%)
IG_like 426..515 CDD:214653 32/101 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.