DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and ush2a

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_009291422.1 Gene:ush2a ZFINID:ZDB-GENE-060503-794 Length:5243 Species:Danio rerio

Alignment Length:426 Identity:83/427 (19%)
Similarity:133/427 (31%) Gaps:150/427 (35%)


  Fly    85 VAW-----------IRHR---------DLHIL-----TVGTYTYT-----TDQRFQ----TSYHR 115
            |:|           :|:|         .||.|     |..::|.|     |:..|:    .||..
Zfish  2468 VSWAAPARHNAPGALRYRLQMRSSASTQLHQLMDDETTTFSHTVTDLEPFTEYHFRLLVSNSYGE 2532

  Fly   116 DIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENR 180
            ....| :.:..||.|...|....:|....||..::.:    ..::.:.|: .:||     |.:||
Zfish  2533 TSSPW-VSLFTAQDRPGAVDPPVLSDIQSRSAFISWS----PPSQPNGII-THYN-----IYQNR 2586

  Fly   181 -----VYQSSNDEFAGMFGPIQ--TVAVPTATILG---------------------GPDLYVDKG 217
                 |.::|.........|.|  |:.|...|..|                     .|.||.|..
Zfish  2587 QLTTSVPENSTSHMLSHLTPFQQYTIQVEACTAAGCTLSAESHTINTPPAPPEDVPAPQLYSDTP 2651

  Fly   218 STINLTCIIKFSPEPPTHIFWYHQDKVLSEETSG--------GRLKFKTIKSEETKSILLIYDAD 274
            :::.|:               :...::::.|..|        |..:..|:.:.:....|...|:.
Zfish  2652 TSVLLS---------------WAAPRLVNGELDGYTVERRVSGTQEISTVATIQPNQTLTYLDSS 2701

  Fly   275 LLHSGKYSCYP----SNTEIASIRVHV-----LQGERPEAMQTNAAPAAVALACWSCHFGQATQA 330
            ...| .:|.|.    ::|.:......|     .:..||..||   .|..|.|...|.   |.|.|
Zfish  2702 ATLS-PWSSYEYRIVAHTRLGGSNSSVWEKVTTRPSRPAGMQ---PPDGVVLGPESV---QVTWA 2759

  Fly   331 -------------------------VRVISTMVAALVLLEACSSLLLQSGGGGGCPGGGS----- 365
                                     :.:::..|:.|:.....|..:|...||||..||.:     
Zfish  2760 APLIPNGEIERYEIRMPEPRIPHTNMSLLTHTVSGLMPYTGYSITILACSGGGGHVGGCTESLPT 2824

  Fly   366 --------PAGGMPTRVREIREKPLTNSLLDPKIPS 393
                    |.|..|..|..|.|..|..|...|..|:
Zfish  2825 LVTTLPTIPQGLSPLSVVAISESFLAVSWQLPSRPN 2860

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 20/92 (22%)
IG_like 210..297 CDD:214653 15/99 (15%)
IGc2 217..287 CDD:197706 10/82 (12%)
ush2aXP_009291422.1 Laminin_G_3 160..297 CDD:290121
Laminin_N 307..528 CDD:295486
EGF_Lam 529..577 CDD:238012
EGF_Lam 586..638 CDD:238012
Laminin_EGF 653..703 CDD:278482
Laminin_EGF 706..756 CDD:278482
EGF_Lam 759..797 CDD:214543
Laminin_EGF 808..857 CDD:278482
EGF_Lam 859..912 CDD:238012
EGF_Lam 913..963 CDD:238012
EGF_Lam 965..1014 CDD:238012
EGF_Lam 1015..1064 CDD:238012
FN3 1177..1253 CDD:238020
FN3 1264..1375 CDD:238020
FN3 1386..1469 CDD:214495
LamG 1537..1699 CDD:238058
LamG 1737..1890 CDD:238058
FN3 1981..2071 CDD:238020
FN3 2163..2253 CDD:238020
FN3 2258..2341 CDD:238020
FN3 2352..2443 CDD:238020
FN3 2447..2544 CDD:238020 16/77 (21%)
FN3 2547..2633 CDD:238020 18/96 (19%)
FN3 2635..2733 CDD:238020 16/114 (14%)
FN3 2743..2807 CDD:238020 11/67 (16%)
FN3 2830..2932 CDD:238020 10/32 (31%)
fn3 2939..3014 CDD:278470
FN3 3032..>3099 CDD:238020
FN3 3542..3611 CDD:238020
FN3 3615..3701 CDD:238020
fn3 3718..3784 CDD:278470
FN3 3801..3887 CDD:238020
FN3 3908..3971 CDD:238020
FN3 3996..4086 CDD:238020
FN3 4186..4284 CDD:238020
fn3 4288..4366 CDD:278470
FN3 4382..4465 CDD:238020
FN3 4470..4553 CDD:238020
FN3 4555..4653 CDD:238020
FN3 4679..4753 CDD:238020
fn3 4760..4830 CDD:278470
FN3 4864..4955 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.