DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and sdk1a

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_009297968.1 Gene:sdk1a ZFINID:ZDB-GENE-081104-374 Length:2245 Species:Danio rerio

Alignment Length:283 Identity:51/284 (18%)
Similarity:93/284 (33%) Gaps:110/284 (39%)


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI 117
            |||.....|.:...|.||..:.|:.:.:....:.|  ::|...|:          :.....::.|
Zfish   416 PYFTAEPRRKMMGEVEKSVDIQCQARGVPMPKLEW--YKDAVPLS----------KLNNPRYKII 468

  Fly   118 DEWTLQIKWAQQRDAGVYEC----QISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAE 178
            ....||::..|..|||:::|    ......|.:|   |::..:..|.|:.               
Zfish   469 SSMGLQVRKLQPSDAGIFQCFARNSAGEAQVHTY---LDVTSMAPAFTAP--------------- 515

  Fly   179 NRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDK 243
                            |:              |:.|..|:....||.:..:|:|.  |.|....:
Zfish   516 ----------------PL--------------DITVTDGAVAAFTCRVSGAPKPA--IVWRRDTQ 548

  Fly   244 VLSEET----------SGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVL 298
            :|:..:          ||| |:.:.:..::|              |.|:||.:|:|         
Zfish   549 ILASGSVQIPRFTLLESGG-LQIQPVVLQDT--------------GNYTCYAANSE--------- 589

  Fly   299 QGERPEAMQTNAAPAAVALACWS 321
                      .|..|:.:|..||
Zfish   590 ----------GAINASASLTVWS 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 15/84 (18%)
IG_like 210..297 CDD:214653 21/97 (22%)
IGc2 217..287 CDD:197706 17/80 (21%)
sdk1aXP_009297968.1 I-set 125..208 CDD:254352
Ig 125..204 CDD:299845
IG_like 222..302 CDD:214653
Ig 236..287 CDD:299845
Ig_3 322..394 CDD:290638
I-set 323..412 CDD:254352
I-set 416..505 CDD:254352 22/104 (21%)
Ig 436..500 CDD:299845 13/76 (17%)
I-set 510..600 CDD:254352 27/171 (16%)
Ig 527..600 CDD:299845 21/109 (19%)
I-set 605..693 CDD:254352
Ig 610..693 CDD:299845
FN3 697..788 CDD:238020
fn3 800..886 CDD:278470
FN3 901..997 CDD:238020
FN3 1002..1090 CDD:238020
FN3 1100..1196 CDD:238020
FN3 1206..1301 CDD:238020
FN3 1308..1397 CDD:238020
FN3 1408..1501 CDD:238020
FN3 1507..1602 CDD:238020
FN3 1616..1722 CDD:238020
FN3 1732..1825 CDD:238020
FN3 1830..1919 CDD:238020
FN3 1931..2021 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.