DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and igsf9a

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_005155702.1 Gene:igsf9a ZFINID:ZDB-GENE-060503-288 Length:1619 Species:Danio rerio

Alignment Length:384 Identity:73/385 (19%)
Similarity:111/385 (29%) Gaps:157/385 (41%)


  Fly    70 SAYLGCRV------KHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQT----------SYHRDID 118
            ||.|.|.:      .......:.|:|                 |.|.|          ..|.|.|
Zfish    36 SAVLPCSLPAPQKDSSASQYVIEWVR-----------------QGFDTPIFMQLGVHPRVHPDYD 83

  Fly   119 -------EWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYI 176
                   ..:||:...|..|.|.|||:|..               :|..|               
Zfish    84 GRVSLFGGTSLQMSGLQLEDEGWYECRILP---------------LDQTT--------------- 118

  Fly   177 AENRVYQSSNDEFAGMFGP---IQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFW 238
                       |.||..|.   :...|.|..|....|::.|..|.::.|.|..:.:|.|.  |.|
Zfish   119 -----------EEAGSSGSWTRLSVTAPPVLTETSPPEVEVFVGRSLTLKCAAQGNPRPT--ITW 170

  Fly   239 ---------YHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIR 294
                     .|:.|:::     |.:.|..:..|.              :|:|.||.||:|..:..
Zfish   171 SKDGAPIKPQHKVKMVN-----GSVSFHAVSREA--------------AGQYQCYTSNSEGNATH 216

  Fly   295 VHVLQGERPEAM-------------------QTNAAPAAVALACWS------CHFGQATQAVRVI 334
            |..|:...|..:                   |..|.|..:... |.      .|.......::||
Zfish   217 VTRLKIIGPPVIIIPPSDTVLNMSQDAKLKCQAEADPPNMTYV-WQRQGVDIYHIDSLKSRIKVI 280

  Fly   335 STMVAALVLLEACSSLLLQSGGGGGCPGGGSPAGGMPTRVREIREKPLTNSLLDPKIPS 393
               |...:|:   |.|..:..|...|    .|..|:|.       .|..:::|..:.|:
Zfish   281 ---VDGTLLI---SRLAPEDSGNYTC----MPTNGLPV-------SPSASAVLTVQHPA 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 21/96 (22%)
IG_like 210..297 CDD:214653 22/96 (23%)
IGc2 217..287 CDD:197706 17/79 (22%)
igsf9aXP_005155702.1 IG_like 27..110 CDD:214653 20/91 (22%)
Ig 35..111 CDD:299845 20/92 (22%)
I-set 140..221 CDD:254352 23/102 (23%)
IGc2 151..212 CDD:197706 19/82 (23%)
Ig 233..318 CDD:299845 18/103 (17%)
I-set 233..318 CDD:254352 18/103 (17%)
Ig <349..402 CDD:299845
IG_like 423..502 CDD:214653
Ig 435..498 CDD:143165
FN3 507..602 CDD:238020
fn3 614..696 CDD:278470
PHA02666 1105..>1312 CDD:222914
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.