DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and sdk1b

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_017211454.1 Gene:sdk1b ZFINID:ZDB-GENE-090311-17 Length:2292 Species:Danio rerio

Alignment Length:371 Identity:77/372 (21%)
Similarity:121/372 (33%) Gaps:102/372 (27%)


  Fly    14 GLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVK 78
            ||.||  ..::.|::..:.|||         .:......|:|.....|.:.:.|.|:..|.|..|
Zfish   433 GLYVC--EATLRNSSQKSTEAK---------AYLSVLESPHFTSKPKRYMIAEVEKNVELQCHAK 486

  Fly    79 HLGNKTVAWIRHR-DLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYEC----- 137
            .:....:.|.:.. .|..|....|..||            ....||::..|..|||:::|     
Zfish   487 GVPTPKLEWFKDAIPLSTLNNSRYKLTT------------SSMVLQVRRIQPDDAGIFQCFAENT 539

  Fly   138 --------------------------------------------------QISTQPVRSYSVNLN 152
                                                              :..:|.:.|.||...
Zfish   540 AGEIQAHTNLVITSMSPLFTTPPSDITVTDGTSAVFTCDTSGAPKPAIVWRKGSQVLASGSVQTP 604

  Fly   153 IVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGP--DLYVD 215
            ...|:::....|:....:|     |.|....:||.|  |:......:.|.:.|.:..|  |..|.
Zfish   605 RFTLLESGGLQILPIMPSD-----AGNYTCLASNTE--GLVNATVALTVLSRTFISTPPEDQRVI 662

  Fly   216 KGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGK 280
            ||:|..|.|.....|.......|....|.||..| |||:..|    |.:..|...:..|:   |.
Zfish   663 KGTTAVLHCAATHDPRVTVRYSWKKGTKPLSVST-GGRVSMK----EGSLQISQTWSGDI---GD 719

  Fly   281 YSC---YPSNTEIASIRVHVLQ-GERPEAMQT--NAAPAAVALACW 320
            |:|   .|:..:..|.|:.|:: ...|..:|.  |...:...|..|
Zfish   720 YTCRVISPAGNDSKSARLEVIELPHSPRNLQVALNETDSRTVLLSW 765

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 19/136 (14%)
IG_like 210..297 CDD:214653 27/92 (29%)
IGc2 217..287 CDD:197706 21/73 (29%)
sdk1bXP_017211454.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.