DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and tutl

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster

Alignment Length:367 Identity:79/368 (21%)
Similarity:125/368 (34%) Gaps:128/368 (35%)


  Fly    60 PRNITSLVGKSAYLGCRVKHL-GNKTVAWIRH----RDLHILTV--------------------G 99
            |.|.|.|.|:.....|..|.: ||.||.|.|.    |::..|..                    |
  Fly   351 PTNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSG 415

  Fly   100 TY----TYTTDQRFQTSYHRDID-----EWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVD 155
            .|    |.........|.:..::     .:|..:::...|.|||.:|.|.:.|...|.       
  Fly   416 QYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYV------- 473

  Fly   156 LIDAETSD--IMQQYYNDDAFYIAE-NRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDK- 216
               ..|.|  :::.|...|...:|. :.::...|:|..|.:......|..||...|..|:.|.| 
  Fly   474 ---TWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKP 535

  Fly   217 ---------------GSTINLTC--IIKFSPEPPTHIFWYHQD-KVLSE------ETSGGRLKFK 257
                           |.::.:.|  :.....|.|| |.|..|: :.|:|      :.|||.:..:
  Fly   536 PAFTVEPETLYQRKVGDSVEMHCDALEAEGTERPT-IKWQRQEGEQLTESQRNRIKISGGNITIE 599

  Fly   258 TIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRV---HVLQGERPEAMQTNAAPAAVALAC 319
            .::.|:              .|.|.|..|| |:|::..   .|::|.:|.      ||..:.   
  Fly   600 NLRRED--------------FGYYQCVVSN-EVATLMAVTQLVIEGTQPH------APYNIT--- 640

  Fly   320 WSCHFGQATQAVRVISTMVAALVLLEACSSLLLQ-----SGG 356
                 |:||:                  ||:.||     |||
  Fly   641 -----GKATE------------------SSITLQWLPGYSGG 659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 24/114 (21%)
IG_like 210..297 CDD:214653 24/115 (21%)
IGc2 217..287 CDD:197706 18/79 (23%)
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352
IGc2 268..331 CDD:197706
I-set 346..437 CDD:254352 19/86 (22%)
Ig 349..437 CDD:299845 19/86 (22%)
Ig 459..530 CDD:299845 18/81 (22%)
IG_like 549..628 CDD:214653 22/95 (23%)
IGc2 551..617 CDD:197706 20/82 (24%)
FN3 633..725 CDD:238020 13/60 (22%)
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.