DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr15

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster

Alignment Length:340 Identity:91/341 (27%)
Similarity:126/341 (37%) Gaps:93/341 (27%)


  Fly    61 RNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIK 125
            :.|.|..|..|||.|.||.|..|.::|:|.||.|||||...|:..|||||:.:..:.:.|:||||
  Fly   197 QTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIK 261

  Fly   126 WAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFA 190
            :.|.:|.|.||||:||:|..|..|:|.||:                                   
  Fly   262 YVQLKDEGTYECQVSTEPKASAIVHLRIVE----------------------------------- 291

  Fly   191 GMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFW-YHQDKVLSEETSGGRL 254
                       |...::|....:|..||.:.|.|||..:.|||..|.| |:|.::......|.|.
  Fly   292 -----------PKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRT 345

  Fly   255 KFKTI--------KSEETKSILLIYDADLLHSGKYSCYPSNTEIAS----------------IRV 295
            :.:.|        .|..|.:...........:......||.|...|                .|.
  Fly   346 EIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRS 410

  Fly   296 HVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVL-LEACSSLLLQSGGGG- 358
            ::|.......:....|.|.||:|               ..|..|.|:. :||.||....|.|.| 
  Fly   411 YILDAISQNDVSELGAAAGVAVA---------------TETSTAQLLTEVEATSSTSGTSTGAGL 460

  Fly   359 -----GCPGGGSPAG 368
                 .....|:.||
  Fly   461 LASTSAAYAAGAAAG 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 40/80 (50%)
IG_like 210..297 CDD:214653 24/112 (21%)
IGc2 217..287 CDD:197706 20/79 (25%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 44/92 (48%)
V-set 204..290 CDD:284989 43/86 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124148507
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5273
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.