DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr17

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster

Alignment Length:283 Identity:88/284 (31%)
Similarity:136/284 (48%) Gaps:63/284 (22%)


  Fly    56 DLTMP-RNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDID- 118
            :|||| .|||:.:|..||:.|::..|.:|.|:|:|.||.||::|...|:..|:|||:.|..|.| 
  Fly   407 NLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDY 471

  Fly   119 EWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQ 183
            .|:||||:.:..|||.||||::|:|..|..|:|.||.                            
  Fly   472 TWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVK---------------------------- 508

  Fly   184 SSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVL--S 246
                              |...::|....:|..||.:.|.||::.:.:||.:|.|:...|.:  |
  Fly   509 ------------------PKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDS 555

  Fly   247 EETSG-----GRLKFKTI-KSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEA 305
            :|.:|     .|..|.|: .::.|...|:|.......||.|:|.|||:...|:.:|||.||    
  Fly   556 DERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGE---- 616

  Fly   306 MQTNAAPAAVALACWSCHFGQAT 328
               .:|.|.::.|..:...|::|
  Fly   617 ---YSASAIMSTAARTTKGGRST 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 37/81 (46%)
IG_like 210..297 CDD:214653 29/95 (31%)
IGc2 217..287 CDD:197706 25/78 (32%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 36/77 (47%)
Ig 415..507 CDD:299845 42/92 (46%)
IG_like 521..612 CDD:214653 29/91 (32%)
IGc2 524..605 CDD:197706 26/81 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124148496
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.