DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr5

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster

Alignment Length:312 Identity:102/313 (33%)
Similarity:155/313 (50%) Gaps:59/313 (19%)


  Fly     1 MLTLWTALFCCLTGLAVCYQRQSVSNN---NHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRN 62
            ||..:......:.||.....:||..::   .|..|..:.::..|.:|..    .:|.||.|..|.
  Fly    39 MLVEYFMALLVIMGLTAPVDKQSRRSSQYFGHLAAAEELSNLIPDNYDA----IDPVFDNTTDRE 99

  Fly    63 ITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWA 127
            :.:.:|.:|.|.|||:|||::.|:|||.|||||||:|..|||.||||...:..:.|||.|:|...
  Fly   100 VIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSV 164

  Fly   128 QQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGM 192
            |||||||||||:||:|..|.:..|.:|      ||                              
  Fly   165 QQRDAGVYECQVSTEPKISLAYKLVVV------TS------------------------------ 193

  Fly   193 FGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFK 257
                      .|.||...:|::..||.||||||...:|.|.||:.| |:|..|..:::.|.::.:
  Fly   194 ----------KAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLW-HKDTELVSDSARGGIRVE 247

  Fly   258 TIKSEETKSILL--IYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQ 307
            :.:..:|.::::  :...|   ||.|:|...|:...|:.||:::.|:..|||
  Fly   248 SEQQMKTSNLVISRVQHTD---SGNYTCSADNSNSDSVFVHIIKSEQHAAMQ 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 46/80 (58%)
IG_like 210..297 CDD:214653 28/89 (31%)
IGc2 217..287 CDD:197706 23/72 (32%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 51/96 (53%)
IG_like 98..179 CDD:214653 47/81 (58%)
IG_like 206..278 CDD:214653 24/76 (32%)
Ig 211..278 CDD:143165 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124148489
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3730
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.