DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr11

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster

Alignment Length:273 Identity:98/274 (36%)
Similarity:132/274 (48%) Gaps:53/274 (19%)


  Fly    52 EPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRD 116
            |||.|.....|:|:.:|..|||.||||.||||:|:|||.||.|||||....:..||||......|
  Fly   116 EPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPD 180

  Fly   117 IDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRV 181
             ..||||||:.|.||||.||||:||:|..|..|.|.:|                           
  Fly   181 -KYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVV--------------------------- 217

  Fly   182 YQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLS 246
                               ||...|||.||.||..||.:.|.||::.:.||||.|.|||..:.|:
  Fly   218 -------------------VPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLA 263

  Fly   247 EETSGGR------LKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEA 305
            .::...|      |...:.:.:.|...|:|..|....:|.|:|.|||:..|::.::::.||...:
  Fly   264 ADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSAS 328

  Fly   306 MQTNAAPAAVALA 318
            ..|::|....|.|
  Fly   329 AVTSSAATTRAYA 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 46/80 (58%)
IG_like 210..297 CDD:214653 31/93 (33%)
IGc2 217..287 CDD:197706 25/76 (33%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 51/92 (55%)
Ig 127..217 CDD:299845 50/91 (55%)
IG_like 227..320 CDD:214653 31/93 (33%)
IGc2 234..311 CDD:197706 26/77 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124148504
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3730
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.