DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr16

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster

Alignment Length:366 Identity:89/367 (24%)
Similarity:134/367 (37%) Gaps:128/367 (35%)


  Fly    28 NHNNAEAKPTHAPPSHYPHGHKWNE-----------------------------PYFDLTM-PRN 62
            |.::..|.|....||..|...|.||                             |...|:: |.|
  Fly   143 NASSGAAPPADIGPSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLN 207

  Fly    63 ITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQT---------------- 111
            .|...|:.|||.|::.....|.::|:|.||.||:.|...|:..|.||.:                
  Fly   208 ATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGAL 272

  Fly   112 ------------SYHRDID-----------EWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNI 153
                        |:...:.           .||||||:....|||.||||::|:|..|..|.|.:
  Fly   273 STTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQLFV 337

  Fly   154 VDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGS 218
            :                                              .|...::|....:|..||
  Fly   338 I----------------------------------------------TPRTELIGDRQRFVKAGS 356

  Fly   219 TINLTCIIKFSPEPPTHIFWYHQDKVLS--EETSGGRLKF----------KTIKSEETKSILLIY 271
            .:.|.||::.:.|.|.:||||..|:.::  .|.||.:..:          .|..:..|...|:|.
  Fly   357 RVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIP 421

  Fly   272 DADLLHSGKYSCYPSNTEIASIRVHVLQGE-RPEAMQTNAA 311
            ....:|||.|:|.|.|:..||:::|||.|| ...|:::.||
  Fly   422 LVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTAA 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 33/119 (28%)
IG_like 210..297 CDD:214653 30/99 (30%)
IGc2 217..287 CDD:197706 25/82 (30%)
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 39/132 (30%)
Ig <298..338 CDD:299845 18/40 (45%)
IG_like 352..447 CDD:214653 30/95 (32%)
Ig 358..439 CDD:143165 24/81 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124148499
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.