DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dscamb

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_009289749.1 Gene:dscamb ZFINID:ZDB-GENE-031118-67 Length:2020 Species:Danio rerio

Alignment Length:244 Identity:48/245 (20%)
Similarity:90/245 (37%) Gaps:77/245 (31%)


  Fly    61 RNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQR-FQTSYHRDIDEWTLQI 124
            :|:|::.|:..|:.||:......::.|  ::|.::|     .:...|| |:       :..||::
Zfish   511 KNVTAIAGRDTYIHCRIIGYPYYSIKW--YKDSNLL-----PFNHRQRAFE-------NNGTLKL 561

  Fly   125 KWAQQRDAGVYECQISTQPV----RSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSS 185
            ...|..|.|.|.|.:...|.    ||..|.:.:..||                         |.|
Zfish   562 SNVQNSDEGEYTCYVLVDPEKQIHRSVHVTVKVPPLI-------------------------QHS 601

  Fly   186 NDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETS 250
            :.:.|.:                        |..:.:.|:: .|.:.|..|.|:...:.::....
Zfish   602 DSQSASI------------------------GQRVFIPCVV-ISGDLPMSITWHKDGRPINASLG 641

  Fly   251 GGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQ 299
                  .||.:.:..|.|.|.:...:|:|.|:|...| |.|::. |.:|
Zfish   642 ------VTIDNIDFTSSLRISNLSEIHNGSYTCIARN-EAAAVE-HSIQ 682

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 18/81 (22%)
IG_like 210..297 CDD:214653 19/87 (22%)
IGc2 217..287 CDD:197706 15/70 (21%)
dscambXP_009289749.1 I-set 132..198 CDD:254352
I-set 225..310 CDD:254352
IGc2 239..300 CDD:197706
IG_like 320..400 CDD:214653
IGc2 328..391 CDD:197706
IG_like 417..501 CDD:214653
Ig 424..498 CDD:143165
IG_like 511..592 CDD:214653 23/95 (24%)
IGc2 518..576 CDD:197706 17/72 (24%)
I-set 595..685 CDD:254352 25/147 (17%)
Ig 612..682 CDD:143165 18/79 (23%)
I-set 689..785 CDD:254352
Ig7_DSCAM 706..785 CDD:143211
IG_like 795..883 CDD:214653
Ig 803..890 CDD:299845
FN3 887..980 CDD:238020
FN3 987..1084 CDD:238020
FN3 1092..1185 CDD:238020
FN3 1190..1279 CDD:238020
IGc2 1302..1367 CDD:197706
FN3 1398..1471 CDD:238020
FN3 1485..1557 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.