DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr20

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster

Alignment Length:310 Identity:81/311 (26%)
Similarity:134/311 (43%) Gaps:84/311 (27%)


  Fly    26 NNNHNNAEAKPTHAP------------PSHYPHGHKWNEPYFD----LTMPRNITSLVGKSAYLG 74
            ::.|..::.:.|.||            ..|:.|..::. |:|:    :....|:|...|.|.:|.
  Fly   227 DSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYG-PHFEDVQRIGQATNLTVQAGSSIHLN 290

  Fly    75 CRVKHLGNKTVAWIRHRD----------LHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQ 129
            ||:..|.:|||:|:||..          |.:||||.:|||.|:|::..:... :.|.|:|...::
  Fly   291 CRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYP-NNWRLKITNVKK 354

  Fly   130 RDAGVYECQISTQPVRSYSVNLNI----VDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFA 190
            .|..:|||||||.|.|...:||::    |.::|.....:.::||..|                  
  Fly   355 DDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEID------------------ 401

  Fly   191 GMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLK 255
                                       ||:.|:|:::......:.:||.|.|.:|:.:.:.|.:.
  Fly   402 ---------------------------STLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVS 439

  Fly   256 FKTIKSEE----TKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGE 301
            .||...|:    |.||..|...|   ||.|:|..|..:..:|.||:|.||
  Fly   440 VKTELMEDGANSTLSIAKISKTD---SGNYTCSISEFQNFTIVVHILNGE 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 34/90 (38%)
IG_like 210..297 CDD:214653 26/91 (29%)
IGc2 217..287 CDD:197706 23/74 (31%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 33/88 (38%)
Ig 279..378 CDD:299845 38/100 (38%)
Ig 400..471 CDD:299845 23/119 (19%)
IG_like 402..480 CDD:214653 24/81 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124148493
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.