DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and itgb4

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio

Alignment Length:81 Identity:20/82 (24%)
Similarity:39/82 (48%) Gaps:24/82 (29%)


  Fly   123 QIKWAQQRDAGVYECQISTQPVRSYSVNLNIVD--LIDAETSDIMQQYYNDDAFYIAENRVYQS- 184
            ::.|...|:|.:   .:::||.|..|:.: |.|  ::|||..   ::|   |::.:..|.|.:| 
Zfish  1414 KVGWGPYREATI---NLASQPTRPMSIPI-IPDIPIVDAEAG---EEY---DSYLMYSNEVLRSP 1468

  Fly   185 -----------SNDEF 189
                       |:|:|
Zfish  1469 TSSLRPSVTDLSDDQF 1484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 4/20 (20%)
IG_like 210..297 CDD:214653
IGc2 217..287 CDD:197706
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776
EGF_2 <468..490 CDD:285248
EGF_2 545..573 CDD:285248
Integrin_B_tail 625..709 CDD:285239
Calx-beta 991..1064 CDD:295344
FN3 1242..1326 CDD:238020
FN3 1331..1420 CDD:238020 1/6 (17%)
fn3 1640..1720 CDD:278470
fn3 1751..1835 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.