DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr4

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster

Alignment Length:349 Identity:121/350 (35%)
Similarity:164/350 (47%) Gaps:97/350 (28%)


  Fly     1 MLTLWTALF--CCLTGLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKW----NEPYFDLTM 59
            ::.||..||  |.:.|..|                       |.||     |    ::||||.:.
  Fly    15 LVPLWLLLFLDCGMVGGEV-----------------------PPHY-----WETPYSQPYFDNSS 51

  Fly    60 PRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQI 124
            .|.:|:.||::|.|.|||::||::.|:|||.|||||||||..|||.|||||:.:....|||||:|
  Fly    52 RREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRI 116

  Fly   125 KWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEF 189
            ...|.||:|.||||:||:|..|....||:|                                   
  Fly   117 SSPQPRDSGTYECQVSTEPKISQGFRLNVV----------------------------------- 146

  Fly   190 AGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRL 254
                       |..|.|||..:|::..||.|||||:...||.||:.|:||...:|::....|| :
  Fly   147 -----------VSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGG-I 199

  Fly   255 KFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALAC 319
            ...|.:|..| |.|||..|....||.|:|.||:::.||:.|||:.||.|.|||            
  Fly   200 NVITERSTRT-SKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQ------------ 251

  Fly   320 WSCHFGQATQAVRVISTMVAALVL 343
               |...:...:|.:|:.....||
  Fly   252 ---HGNSSATCLRPLSSTSVPFVL 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 47/80 (59%)
IG_like 210..297 CDD:214653 36/87 (41%)
IGc2 217..287 CDD:197706 31/70 (44%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 52/93 (56%)
IG_like 53..145 CDD:214653 52/92 (57%)
ig 153..227 CDD:278476 31/76 (41%)
IG_like 161..>227 CDD:214653 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124148482
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3730
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.