DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and Sdk1

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_808547.3 Gene:Sdk1 MGIID:2444413 Length:2193 Species:Mus musculus

Alignment Length:479 Identity:104/480 (22%)
Similarity:169/480 (35%) Gaps:146/480 (30%)


  Fly    16 AVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKS-AYLGC--RV 77
            |..|..|:|:..|..|..:...|...:.....|:...|.. :..|.|.:.:.|.| ..|.|  ..
Mouse   238 AGAYYVQAVNEKNGENKTSPFIHLSVARDTGTHEAMAPII-VVAPGNRSVVAGSSETTLECIANA 301

  Fly    78 KHLGNKTVAWIRH--RDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQIS 140
            :.:...:|.|.|:  |    ||.|.::|..               .|.|......|.|:|.|:.:
Mouse   302 RPVEELSVHWKRNGVR----LTSGLHSYGR---------------RLTITNPTSADTGMYVCEAT 347

  Fly   141 T-----QPVRSYSVNLNIVD----------LIDAETSDIMQ-------------QYYNDDAFYIA 177
            .     :|.|:.:. |:|::          .|..|..:.|.             |:|. ||..::
Mouse   348 LRGSTFEPARARAF-LSIIEPPYFTAEPESRILGEVEETMDIPCRAMGVPLPTLQWYK-DAVPLS 410

  Fly   178 --ENRVY----------QSSNDEFAGMF--------GPIQTVAVPTATILGGP------DLYVDK 216
              :|..|          |..:.|.:|:|        |.:||......|.:...      |..|..
Mouse   411 KLQNPRYKVLPSGGLHIQKLSPEDSGIFQCFASNEGGEVQTHTYLDVTNIAPAFTQRPVDTTVTD 475

  Fly   217 GSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGG-RL-KFKTIKSEETK-SILLIYDADLLHS 278
            |.|..|.|.:..:|:|.  |.|...:.:|:   ||. |: :|..::|...: :.:.|.||     
Mouse   476 GMTAVLRCEVSGAPKPA--ITWKRGNHILA---SGSVRIPRFMLLESGGLRIAPVFIQDA----- 530

  Fly   279 GKYSCYPSNTEIASIR-------------VH------VLQGERPEAMQTNAAPAAVALACWSCHF 324
            |.|:||.:||| ||:.             ||      |::|            ....|.|.:.| 
Mouse   531 GNYTCYAANTE-ASVNASAMLTVWNRTSIVHPPEDRVVIKG------------TTATLCCGATH- 581

  Fly   325 GQATQAVR--------VISTMVAALVLLEACSSLLLQSGGGGG-----C---PGGGSPAGGMPTR 373
             ....::|        ||:...::.:::|...||::.....|.     |   ..|||.:......
Mouse   582 -DPRTSLRYVWKKDNVVITASSSSRIVVEKDGSLVISQTWSGDIGDYTCEIISEGGSDSRTARLE 645

  Fly   374 VREIREKP--LTNSLLDPKIPSTT 395
            |.|:...|  |..||...:..|.|
Mouse   646 VIELPHPPQNLLASLSPARSHSVT 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 18/90 (20%)
IG_like 210..297 CDD:214653 30/115 (26%)
IGc2 217..287 CDD:197706 21/73 (29%)
Sdk1NP_808547.3 Ig 476..552 CDD:299845 26/87 (30%)
I-set 557..646 CDD:254352 18/103 (17%)
Ig 562..646 CDD:299845 16/98 (16%)
FN3 650..741 CDD:238020 6/21 (29%)
fn3 753..839 CDD:278470
FN3 854..949 CDD:238020
FN3 954..1036 CDD:238020
FN3 1052..1148 CDD:238020
FN3 1158..1253 CDD:238020
FN3 1261..1349 CDD:238020
FN3 1360..1453 CDD:238020
FN3 1459..1554 CDD:238020
FN3 1562..1676 CDD:238020
FN3 1686..1779 CDD:238020
FN3 1784..1865 CDD:238020
FN3 1885..1978 CDD:238020
PDZ-binding. {ECO:0000250|UniProtKB:Q6V4S5} 2187..2193
Ig_2 94..169 CDD:290606
IG_like 100..169 CDD:214653
IG_like 183..263 CDD:214653 7/25 (28%)
Ig 197..247 CDD:299845 4/9 (44%)
IG_like 281..357 CDD:214653 21/95 (22%)
IGc2 294..347 CDD:197706 16/72 (22%)
I-set 368..457 CDD:254352 16/90 (18%)
Ig 388..454 CDD:143165 13/67 (19%)
I-set 462..552 CDD:254352 28/101 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.