DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr8

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster

Alignment Length:364 Identity:129/365 (35%)
Similarity:187/365 (51%) Gaps:96/365 (26%)


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI 117
            |.||.|:..|||.||||:..|.||||:|||:||:|:||||:|:||||.||||:||||:..:....
  Fly    42 PTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHA 106

  Fly   118 DEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVY 182
            ::|||:|::||::|:|:|||||||.|...:||.||||:                           
  Fly   107 EDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVE--------------------------- 144

  Fly   183 QSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSE 247
                               |...|:|||:|::::|||||||||:||:||||..:.|.|..::::.
  Fly   145 -------------------PVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINF 190

  Fly   248 ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQT---- 308
            ::..|.:...|.|...|.|.||:..|....||.|:|.|||....|:|||::.||.|.||.|    
  Fly   191 DSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTGNNG 255

  Fly   309 ----NAAPAAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQSGGGGGCPGGGSPAGG 369
                :..|..:.|...:|            ||:: .|.|:.:||:|:              ||  
  Fly   256 NSTASQPPVLLPLVLLTC------------STLM-LLQLVASCSTLV--------------PA-- 291

  Fly   370 MPTRVREIREKPLTNSLLDPKIPSTTSAERVNNGSRNAR 408
            .|...|.:::             ::|.||....|.|:.|
  Fly   292 TPPGCRTVQQ-------------ASTFAEEKAMGQRSNR 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 49/80 (61%)
IG_like 210..297 CDD:214653 38/87 (44%)
IGc2 217..287 CDD:197706 31/70 (44%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 50/80 (63%)
V-set 52..143 CDD:284989 55/91 (60%)
IG_like 153..238 CDD:214653 36/85 (42%)
ig 153..232 CDD:278476 34/79 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3730
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.