DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr14

DIOPT Version :10

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:309 Identity:93/309 - (30%)
Similarity:138/309 - (44%) Gaps:71/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 THAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHR--DLHILTVG 99
            ||.|   :|.   :.:||..|    ||::.:..|.||.|||..|..|||:|:|.|  ||.::|.|
  Fly    68 THEP---FPF---FADPYTTL----NISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFG 122

  Fly   100 TYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNI----VDLIDAE 160
            .:||:.|.|:...: .:.::|.|.|::|.:||.|.||||:|:.|.....|.|.|    |:::|..
  Fly   123 QHTYSGDSRYSLEF-EEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDER 186

  Fly   161 TSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCI 225
            .|...::||.                                             .||||.|.|:
  Fly   187 GSATPEKYYK---------------------------------------------AGSTIELQCV 206

  Fly   226 IKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKT-IKSEETKSILLIYDADLLHSGKYSCYPSNTE 289
            |...|.|.::|.|.|..::|:.:||.|.:..|| :......|.|.|.:|:...:|.|:|...|..
  Fly   207 ISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEI 271

  Fly   290 IASIRVHVLQGERPEAMQ--------TNAAPAAVALACWSCHFGQATQA 330
            ..::.||||.||.|.|||        .||:...|....:.|..|..:.|
  Fly   272 TETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVCISGSISVA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 53..138 CDD:472250 35/86 (41%)
Ig strand B 71..75 CDD:409371 2/3 (67%)
Ig strand E 120..124 CDD:409371 2/3 (67%)
Ig_3 214..287 CDD:464046 25/73 (34%)
dpr14NP_572419.1 Ig 81..175 CDD:472250 39/98 (40%)
Ig strand B 92..96 CDD:409353 2/3 (67%)
Ig strand C 105..109 CDD:409353 2/3 (67%)
Ig strand E 142..146 CDD:409353 2/3 (67%)
Ig strand F 156..161 CDD:409353 3/4 (75%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 29/132 (22%)
Ig strand B 201..205 CDD:409473 2/3 (67%)
Ig strand C 214..220 CDD:409473 1/5 (20%)
Ig strand E 248..252 CDD:409473 2/3 (67%)
Ig strand F 262..267 CDD:409473 2/4 (50%)

Return to query results.
Submit another query.