DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and Kirrel3

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_017451106.1 Gene:Kirrel3 RGDID:1311382 Length:784 Species:Rattus norvegicus

Alignment Length:378 Identity:85/379 (22%)
Similarity:135/379 (36%) Gaps:121/379 (32%)


  Fly    12 LTGLAVCYQRQSVSNNN----HNNAEAKPTHAPPSHYPHGHKWNE------------PYFDLTMP 60
            |..|:|  :.|.|..:|    |.:|:|.|..........||...|            .||...:.
  Rat   257 LVNLSV--EPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVS 319

  Fly    61 RNITSLVGKS-------AYLGCRVK--------HLGNKTV---AWIRHRDLHILTV--GTYTYTT 105
            ..:|:.:|.:       .|.|.|:.        .||:..|   |||.:..|.|:.:  |:....:
  Rat   320 CEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLS 384

  Fly   106 DQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYN 170
            :::            ||.:|..:|.|||.|.|:.             :|..:.|           
  Rat   385 NEK------------TLTLKSVRQEDAGKYVCRA-------------VVPRVGA----------- 413

  Fly   171 DDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTH 235
                  .|..|..:.|       ||....:..|...|.|     :||   .:.|.|:.:| ||..
  Rat   414 ------GEREVTLTVN-------GPPIISSTQTQHALHG-----EKG---QIKCFIRSTP-PPDR 456

  Fly   236 IFWYHQDKVLSEETSGGRLKFKTIKSEE----TKSILLIYDADLLHSGKYSC-----YPSNTEIA 291
            |.|..::.||...|| ||...:|:.:||    |.:|..|..||.  ...|:|     :.|:|||.
  Rat   457 IAWSWKENVLESGTS-GRYTVETVNTEEGVISTLTISNIVRADF--QTIYNCTAWNSFGSDTEII 518

  Fly   292 SIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVLL 344
            .::....:.:....::..:.|.||.:..             .:...||.|||:
  Rat   519 RLKEQGSEMKSGAGLEAESVPMAVIIGV-------------AVGAGVAFLVLM 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/100 (23%)
IG_like 210..297 CDD:214653 29/96 (30%)
IGc2 217..287 CDD:197706 25/79 (32%)
Kirrel3XP_017451106.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.