DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr10 and dpr1

DIOPT Version :10

Sequence 1:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:276 Identity:103/276 - (37%)
Similarity:139/276 - (50%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI 117
            ||||..:|||:|..||::.:|.|||:.||:|.|:|||.|||||||.|..|||:|||||.......
  Fly    53 PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGS 117

  Fly   118 DEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVY 182
            ..||||||:.|.||:|||||||:|:|..|.|...|:|:|                          
  Fly   118 ANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVEL-------------------------- 156

  Fly   183 QSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSE 247
                                .|.|.|..||.|..||.|||||.|...|....:||||...::|..
  Fly   157 --------------------KAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDG 201

  Fly   248 ------ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAM 306
                  ::|..|::.:...::...|.|.|..|....:|.|:|.|:..:.:|:.|||:.||.|.||
  Fly   202 KGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAM 266

  Fly   307 QTNAAPAAVALACWSC 322
            |.|::..:.:..|..|
  Fly   267 QHNSSSNSNSFYCGIC 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 53..138 CDD:472250 50/84 (60%)
Ig strand B 71..75 CDD:409371 1/3 (33%)
Ig strand E 120..124 CDD:409371 3/3 (100%)
Ig_3 214..287 CDD:464046 25/78 (32%)
dpr1NP_995908.2 Ig 53..138 CDD:472250 50/84 (60%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 2/7 (29%)
CDR1 77..83 CDD:409355 3/5 (60%)
Ig strand C 84..90 CDD:409355 3/5 (60%)
CDR2 93..109 CDD:409355 11/15 (73%)
Ig strand D 109..114 CDD:409355 2/4 (50%)
FR3 110..147 CDD:409355 19/36 (53%)
Ig strand E 119..125 CDD:409355 4/5 (80%)
Ig strand F 133..148 CDD:409355 10/14 (71%)
CDR3 148..160 CDD:409355 5/57 (9%)
IG_like 163..257 CDD:214653 29/93 (31%)
Ig strand B 174..178 CDD:409355 3/3 (100%)
Ig strand C 189..193 CDD:409355 2/3 (67%)
Ig strand E 226..230 CDD:409355 2/3 (67%)
Ig strand F 240..244 CDD:409355 1/3 (33%)

Return to query results.
Submit another query.