DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr1

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster

Alignment Length:276 Identity:103/277 (37%)
Similarity:139/277 (50%) Gaps:52/277 (19%)


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI 117
            ||||..:|||:|..||::.:|.|||:.||:|.|:|||.|||||||.|..|||:|||||.......
  Fly    53 PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGS 117

  Fly   118 DEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVY 182
            ..||||||:.|.||:|||||||:|:|..|.|...|:|:|                          
  Fly   118 ANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVEL-------------------------- 156

  Fly   183 QSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSE 247
                                .|.|.|..||.|..||.|||||.|...|....:||||...::|..
  Fly   157 --------------------KAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDG 201

  Fly   248 ------ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAM 306
                  ::|..|::.:...::...|.|.|..|....:|.|:|.|:..:.:|:.|||:.||.|.||
  Fly   202 KGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAM 266

  Fly   307 QTNAAPAAVALACWSC 322
            |.|::..:.:..|..|
  Fly   267 QHNSSSNSNSFYCGIC 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 47/80 (59%)
IG_like 210..297 CDD:214653 30/93 (32%)
IGc2 217..287 CDD:197706 24/76 (32%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 54/95 (57%)
IG_like 60..150 CDD:214653 53/90 (59%)
IG_like 163..257 CDD:214653 30/94 (32%)
Ig 174..244 CDD:143165 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3730
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.