DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and dpr9

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster

Alignment Length:384 Identity:130/385 (34%)
Similarity:187/385 (49%) Gaps:88/385 (23%)


  Fly    12 LTGL--AVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLG 74
            :||:  :..::..|.|:|..::..|...|............. ||||....:|:|:|:||:|||.
  Fly   214 ITGIPSSSLHKASSASSNTFSSQLASGFHRNSIDLEEARNAG-PYFDKAFSKNVTALLGKTAYLN 277

  Fly    75 CRVKHLGNKT----VAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVY 135
            ||||:|||||    |:|:||||:|:||||.||||:||||:..:....::|.||||:.|.||:|:|
  Fly   278 CRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIY 342

  Fly   136 ECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVA 200
            |||:||.|..|:.::||:|:                                             
  Fly   343 ECQVSTTPHMSHYIHLNVVE--------------------------------------------- 362

  Fly   201 VPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD------KVLSEETSGGRLKFKTI 259
             |:..|:|.||||::.||||||||||:.|||||.:|||.|.:      ::::.::..|.:...|.
  Fly   363 -PSTEIIGAPDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTN 426

  Fly   260 KSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQ----TNAA--------- 311
            |.:.|.|.|||..|....||.|.|.|||.:..|:.||||.|......:    :|||         
  Fly   427 KGDTTTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPL 491

  Fly   312 --------PAAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQSGGGGGCPG 362
                    |..|.|...:|.:        :.:.:.|||.......|....:|...|.||
  Fly   492 AHSLSVCVPVCVLLQLGACRW--------IAALLGAALATPPPLRSTRRATGERPGSPG 542

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 50/84 (60%)
IG_like 210..297 CDD:214653 42/93 (45%)
IGc2 217..287 CDD:197706 34/76 (45%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 55/98 (56%)
IG_like 263..360 CDD:214653 55/97 (57%)
IG_like 371..464 CDD:214653 42/93 (45%)
IGc2 377..456 CDD:197706 35/79 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124148470
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23279
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.