DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and Ptprq

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001357916.1 Gene:Ptprq MGIID:1096349 Length:2301 Species:Mus musculus

Alignment Length:290 Identity:60/291 (21%)
Similarity:97/291 (33%) Gaps:88/291 (30%)


  Fly    58 TMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTL 122
            |:|..:.|:...:|:...:...:   |:.||: .|..:.....|..||..|.|     ...||..
Mouse  1426 TLPETVPSVPTNTAFSNVQSTSV---TLRWIK-PDTILGYFQNYKITTQLRAQ-----KCREWEP 1481

  Fly   123 QIKWAQQRDAGVYECQISTQPVR-SYSVNLNIVDLIDAETSDIMQ-----QYYNDDAFYIAENRV 181
            :            || :..|.|: .|..|         :|.|.::     |:|.   |.:|    
Mouse  1482 E------------EC-VEHQEVQYLYEAN---------QTEDTVRGLKKFQWYR---FQVA---- 1517

  Fly   182 YQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSP--------EP-----P 233
             .|:|..:......|.|..:|     |.||     |...|:. ::..||        ||     |
Mouse  1518 -ASTNAGYGNASSWISTQTLP-----GPPD-----GPPENVR-VVATSPFGINISWNEPAIITGP 1570

  Fly   234 THIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLH-------------SGKYSCYP 285
            |    ::...|.|.:.....:.|  :||.|......|.|.::..             ||.|:...
Mouse  1571 T----FYLIDVKSVDNDNFNISF--VKSNEENKTTEINDLEVFTRYSVVITAFVGNVSGAYTDGK 1629

  Fly   286 SNTEIASIRVHVLQGERPEAMQTNAAPAAV 315
            |:.|:....:..:..:.|..|.....|..|
Mouse  1630 SSAEVIITTLESVPKDPPNNMTFQKIPDEV 1659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 16/80 (20%)
IG_like 210..297 CDD:214653 23/113 (20%)
IGc2 217..287 CDD:197706 20/96 (21%)
PtprqNP_001357916.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.