DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and Igsf9b

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b MGIID:2685354 Length:1443 Species:Mus musculus

Alignment Length:287 Identity:67/288 (23%)
Similarity:94/288 (33%) Gaps:92/288 (32%)


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVK-HLGNKTVAWIRHRDLHILTVGTYTYTTDQR--FQTSYH 114
            |.|.::.|.|||..:.:.|.|.||.: :.||.|..|               |..|:.  ||....
Mouse   230 PPFIVSPPENITVNISQDALLTCRAEAYPGNLTYTW---------------YWQDENVYFQNDLK 279

  Fly   115 ---RDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYI 176
               |.:.:.||.|...:..|||.|.|..|....||.|.:..:                       
Mouse   280 LRVRILIDGTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYL----------------------- 321

  Fly   177 AENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQ 241
                                 ||..|...:...|.:||..|....:.|.:...| |.|.:.|...
Mouse   322 ---------------------TVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEP-PATVVKWNKD 364

  Fly   242 DKVLSEETSGG--RLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNT-----EIASIRV---- 295
            .:.|..|.:.|  .::..:|:.||.....|         |.|:|.|.||     :.|..|:    
Mouse   365 GRPLQVEKNLGWTLMEDGSIRIEEATEEAL---------GTYTCVPYNTLGTMGQSAPARLVLKD 420

  Fly   296 ----HVLQG--ERPEAMQTNAAPAAVA 316
                .||.|  .|.||.:....|.|.|
Mouse   421 PPYFTVLPGWEYRQEAGRELLIPCAAA 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 24/86 (28%)
IG_like 210..297 CDD:214653 24/102 (24%)
IGc2 217..287 CDD:197706 17/72 (24%)
Igsf9bXP_011240777.1 IG_like 32..117 CDD:214653
Ig 43..117 CDD:143165
I-set 141..227 CDD:254352
IGc2 155..212 CDD:197706
I-set 231..323 CDD:254352 31/151 (21%)
Ig 237..323 CDD:299845 30/145 (21%)
IG_like 333..416 CDD:214653 24/93 (26%)
Ig <355..416 CDD:299845 18/70 (26%)
IG_like 428..507 CDD:214653 7/21 (33%)
Ig 444..507 CDD:299845 2/5 (40%)
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.