DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and IGSF9B

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_011540993.1 Gene:IGSF9B HGNCID:32326 Length:1539 Species:Homo sapiens

Alignment Length:355 Identity:76/356 (21%)
Similarity:121/356 (34%) Gaps:125/356 (35%)


  Fly     4 LW---TALFCCL----TGLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPR 61
            ||   :.|..|.    .|...|.|.|:|.....:.....|.       .||.: .||.|      
Human    80 LWPLASLLVVCAPEMERGPVTCTQAQTVRGRTGHRRRFGPG-------AHGLR-EEPEF------ 130

  Fly    62 NITSLVGKSAYLGCRVKH--LGNK---TVAWIRHR-DLHI-LTVGTYTYTTDQRF--QTSYHRDI 117
             :|:..|:|..|.|.|.|  .|..   .|.|.:.. .:.| :..|.|....|..:  :.|.|   
Human   131 -VTARAGESVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLH--- 191

  Fly   118 DEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVY 182
            |:.:|:::..:..|.|.|||::.               ::|       |||   |.|:       
Human   192 DKASLRLEQVRSEDQGWYECKVL---------------MLD-------QQY---DTFH------- 224

  Fly   183 QSSNDEFAGMFGPIQTVAVPTATILGGPDLYVD--KGSTINLTCIIKFSPEPPTHIFWYHQDKVL 245
                   .|.:..:...|.||.|  ..|..|::  :|.:|.:||....:|:|  .:.|..:..:|
Human   225 -------NGSWVHLTINAPPTFT--ETPPQYIEAKEGGSITMTCTAFGNPKP--IVTWLKEGTLL 278

  Fly   246 SE----ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGER---- 302
            ..    :.|.|.|...::..|:              .|.|:|          |.:.:|||.    
Human   279 GASGKYQVSDGSLTVTSVSRED--------------RGAYTC----------RAYSIQGEAVHTT 319

  Fly   303 -------------PEAMQTNAAPAAVALAC 319
                         ||.:..|.:..|: |.|
Human   320 HLLVQGPPFIVSPPENITVNISQDAL-LTC 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/89 (26%)
IG_like 210..297 CDD:214653 18/93 (19%)
IGc2 217..287 CDD:197706 15/74 (20%)
IGSF9BXP_011540993.1 IG_like 128..213 CDD:214653 25/95 (26%)
Ig 139..213 CDD:143165 20/77 (26%)
I-set 237..323 CDD:254352 24/114 (21%)
IGc2 251..308 CDD:197706 16/83 (19%)
I-set 327..419 CDD:254352 6/24 (25%)
Ig 333..419 CDD:299845 6/18 (33%)
IG_like 429..512 CDD:214653
Ig <451..512 CDD:299845
IG_like 524..603 CDD:214653
Ig 533..603 CDD:299845
FN3 608..703 CDD:238020
FN3 719..801 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.