DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and zig-8

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans

Alignment Length:265 Identity:60/266 (23%)
Similarity:113/266 (42%) Gaps:60/266 (23%)


  Fly    61 RNITSLVGKS-AYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQI 124
            :.|.::|.:: |||.|.|.......:||.|..|..:||.|..|:|.|.|:|.| .:..:.|.|.:
 Worm    42 QTIVNVVAENPAYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVS-KKSANIWVLNL 105

  Fly   125 KWAQQRDAGVYECQISTQPVRSYSVNLNIVD-------LIDAETSDIMQQYYNDDAFYIAENRVY 182
            :.|:|:|:|.|.|:|:.:....|:|.|.:::       .:..:::.:|.....|:.  :....|.
 Worm   106 RRAEQQDSGCYLCEINDKHNTVYAVYLKVLEPPLPSPSSLQKKSTKLMANMSGDEV--VLNCTVT 168

  Fly   183 QSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSE 247
            .:..||        :.:.|          ::...|:|||.....|:               :|..
 Worm   169 STDKDE--------EVLDV----------VWTRDGNTINFNDTEKY---------------ILKV 200

  Fly   248 ETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAA- 311
            :...| :..:|::         |..|.:...|.|:|..|..:.:.| ||:   .:.||..:|:| 
 Worm   201 KRDAG-VVIETMR---------IRKATMEDDGNYACEHSQQKASQI-VHI---NKAEAQTSNSAT 251

  Fly   312 -PAAV 315
             |.::
 Worm   252 FPCSI 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 29/81 (36%)
IG_like 210..297 CDD:214653 17/87 (20%)
IGc2 217..287 CDD:197706 14/70 (20%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 28/80 (35%)
Ig 55..129 CDD:143165 26/75 (35%)
ig 158..229 CDD:278476 18/116 (16%)
IG_like 158..227 CDD:214653 18/114 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134633546
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3730
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000585
OrthoInspector 1 1.000 T374830
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23279
Phylome 1 0.910 0.893 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.