DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and Papln

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001192272.1 Gene:Papln MGIID:2386139 Length:1302 Species:Mus musculus

Alignment Length:319 Identity:57/320 (18%)
Similarity:88/320 (28%) Gaps:109/320 (34%)


  Fly    33 EAKPTHAPPSHYPH---------------GHKWNEP---------YFDLTMPRNITSLVGKSAYL 73
            |.:|.|.|....|.               ||:...|         ..|.|.|..:.:..|:...|
Mouse  1021 EGQPRHFPEPRNPDLGHGPPHRGTGAEAGGHRVLSPSHPRPATRLRLDRTQPGVVDASPGQRIRL 1085

  Fly    74 GCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQ 138
            .||.:.....|:.|  .||             .|...:..|:...:.:|.|......|.|.|.| 
Mouse  1086 TCRAEGFPVPTIEW--QRD-------------GQLVSSPRHQVQPDGSLVISRVDVEDGGYYSC- 1134

  Fly   139 ISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPT 203
                              :.....|..|::                           :|...:..
Mouse  1135 ------------------VAFNGQDRDQRW---------------------------VQLRVLRE 1154

  Fly   204 ATILG-GPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSI 267
            .||.| .|.:.|.:|.|..|.|::   .....:|.|....  |..:..|.|:      .:.....
Mouse  1155 LTITGLPPAVTVAEGDTARLLCVV---AGESVNIRWSRNG--LPIQADGHRV------HQSPDGT 1208

  Fly   268 LLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQ 326
            |||::......|.|:|            ...:|.:..:..|....|..|.|..|...|:
Mouse  1209 LLIHNLRPRDEGSYTC------------SAFRGSQAVSRSTEVKVALPAPAAQSRDLGK 1255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 16/80 (20%)
IG_like 210..297 CDD:214653 17/87 (20%)
IGc2 217..287 CDD:197706 15/70 (21%)
PaplnNP_001192272.1 TSP1 30..81 CDD:214559
ADAM_spacer1 184..299 CDD:283607
TSP1 309..362 CDD:214559
TSP1 389..447 CDD:214559
TSP1 447..504 CDD:214559
TSP1 511..562 CDD:214559
Kunitz_BPTI 771..823 CDD:278443
Papilin_u7 831..922 CDD:293232
Ig 932..>995 CDD:299845
IG_like 1072..1151 CDD:214653 20/140 (14%)
IGc2 1079..1138 CDD:197706 16/93 (17%)
I-set 1157..1241 CDD:254352 21/107 (20%)
IGc2 1168..1226 CDD:197706 15/81 (19%)
PLAC 1257..1289 CDD:285849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.