DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and ncam1b

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_005157462.1 Gene:ncam1b ZFINID:ZDB-GENE-010822-2 Length:1055 Species:Danio rerio

Alignment Length:298 Identity:65/299 (22%)
Similarity:99/299 (33%) Gaps:102/299 (34%)


  Fly    54 YFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDID 118
            :.::..|:..|.  |.:|.:.|.|......||.| :::...|      .:..|.||:|     :.
Zfish   117 FTNVPSPQEFTE--GDNAIIVCDVISSPPPTVLW-KYKGAKI------QFDKDVRFKT-----LS 167

  Fly   119 EWTLQIKWAQQRDAGVYECQ--ISTQ---PVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAE 178
            ...|||:..::.|.|||.|:  |..:   ..||..|.:|::..|                     
Zfish   168 NNHLQIRGIRKTDEGVYTCEGRIKARGEVDFRSIKVVVNVLPTI--------------------- 211

  Fly   179 NRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDK 243
             |:.|:..:..|                        |.|.:..|.|.....|||  .:.|...:.
Zfish   212 -RIRQAETNATA------------------------DMGFSTLLACDPDGFPEP--IVTWRRNNA 249

  Fly   244 VLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN-----TEIASIRVHVLQGERP 303
            .|.   ||.:..|....||.|     :.|...|..|.|:|...|     .:..|::|.|    :|
Zfish   250 PLE---SGNKYSFNEDGSEMT-----VLDVTKLDEGDYTCIAKNKAGESEQELSLKVFV----QP 302

  Fly   304 -----EAMQTNAAPAAVALAC-----------WSCHFG 325
                 |:..|......|.|.|           ||  ||
Zfish   303 KITYLESQTTTEMDEQVTLTCEATGDPTPTITWS--FG 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 22/85 (26%)
IG_like 210..297 CDD:214653 23/92 (25%)
IGc2 217..287 CDD:197706 19/70 (27%)
ncam1bXP_005157462.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..205 CDD:214653 26/98 (27%)
IGc2 128..189 CDD:197706 20/75 (27%)
Ig 208..301 CDD:299845 28/153 (18%)
I-set 212..298 CDD:254352 25/120 (21%)
I-set 298..414 CDD:254352 12/48 (25%)
Ig 300..414 CDD:299845 11/46 (24%)
IG_like 426..505 CDD:214653
Ig 434..505 CDD:143165
FN3 513..606 CDD:238020
FN3 629..720 CDD:238020
Chorion_3 <815..1019 CDD:253174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.