DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and lrit3

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_002934296.1 Gene:lrit3 XenbaseID:XB-GENE-6076513 Length:652 Species:Xenopus tropicalis

Alignment Length:357 Identity:76/358 (21%)
Similarity:124/358 (35%) Gaps:106/358 (30%)


  Fly    57 LTMPRNITSLVGKSAYLGCRVKHLGNKT--VAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDE 119
            :|....|||.:|.:..|.|...  ||.|  :.|.|..:      ....||..|...|    |...
 Frog   259 MTSATKITSPLGSNVLLRCDAS--GNPTPQLLWSRTNN------SAANYTVVQETPT----DGVR 311

  Fly   120 WT-LQIKWAQQRDAGVYECQIST-QPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVY 182
            |: |.:.....:|||.|.|:... ..|...|:.:.:|.::....|.     :..|....||    
 Frog   312 WSILSMNGISYKDAGEYRCKAKNFAGVAEASITVIVVGVVTTTASS-----HRFDRRLGAE---- 367

  Fly   183 QSSN---------DEFAGMFGPIQTVAVP---TATILGGPDLYVDKGSTINLTCIIKFSPE---- 231
            |.||         .:.:..:.|:|...||   |.|.|         .:|::.|.|:..:|:    
 Frog   368 QMSNMQTEAKEELSKISTTWFPLQLSTVPMLQTDTPL---------TATVSPTSIVLTTPKVPKI 423

  Fly   232 ----------------------PPTHIFWYHQD------KVLSEETSGGRLKFKTIKSEETKSIL 268
                                  .||.    .|:      ||:||......|.:||..:..:.|:.
 Frog   424 KLPKPAPATKKNPKMSTQQAANKPTS----EQNAVVGNLKVISESEDRVTLTWKTFNTTNSASLA 484

  Fly   269 LIY----DADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQ 329
            ::|    :.::|   |.|..||..::      .:.|..|....       :|..|......:..|
 Frog   485 VLYSKYGEEEML---KLSTDPSKNKV------TIDGLEPNTRY-------MACVCPKASQPKKDQ 533

  Fly   330 AVRVISTMVAALVLLEACSSL-LLQSGGGGGC 360
            .: |.||  .:|:.:|:.|.: :|......||
 Frog   534 CI-VFST--DSLLPIESSSQVSVLVIASSVGC 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 23/84 (27%)
IG_like 210..297 CDD:214653 21/123 (17%)
IGc2 217..287 CDD:197706 21/106 (20%)
lrit3XP_002934296.1 leucine-rich repeat 59..82 CDD:275378
leucine-rich repeat 83..106 CDD:275378
LRR_8 105..165 CDD:290566
LRR_RI <107..190 CDD:238064
leucine-rich repeat 107..130 CDD:275378
leucine-rich repeat 131..154 CDD:275378
leucine-rich repeat 155..168 CDD:275378
Ig 255..338 CDD:299845 24/91 (26%)
IG_like 265..342 CDD:214653 24/89 (27%)
FN3 455..518 CDD:214495 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.