DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and papln

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_004917291.1 Gene:papln XenbaseID:XB-GENE-855687 Length:1198 Species:Xenopus tropicalis

Alignment Length:372 Identity:73/373 (20%)
Similarity:118/373 (32%) Gaps:131/373 (35%)


  Fly    29 HNNAEAKPTHAPPSHYPHGHK--------WNEPYFDLTMPR----NITSLVGKSAYLGCRVKHLG 81
            |::.|:..:|.........||        .:...:.:.:.:    ::.::.|::|:|.|:|....
 Frog   817 HSHGESSTSHIRNGDITERHKTKTDTNTSQHSSVYSIILDKVKFSSMETIRGQTAHLPCQVSDYP 881

  Fly    82 NKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVR- 145
            ...:.|.:.... :|....|.|..|             .:|.|......|||.|:|..|:...| 
 Frog   882 FSNIEWQKDGQA-LLPSSKYIYNPD-------------GSLVINRVHSEDAGEYKCLASSGSRRE 932

  Fly   146 SYSVNLNIVDL-------IDAE--TSDIMQQYYNDDAFYIAEN------------------RVYQ 183
            |:.|.|.:.||       ::|.  |.|...|..:.|....|:.                  .|:.
 Frog   933 SHRVRLQVKDLGAQGAQRVNASQATKDTRNQPLHSDRRGSAKTPLVIDASLGHRTRLPCLLEVHS 997

  Fly   184 SSNDEFAGMFGPIQT----------------------VAVPTAT-------------------IL 207
            |:|.|:.....|:.:                      :...|||                   |.
 Frog   998 STNVEWQKDGKPLSSPRHRKQSDGSLTISRMSPDDAGIYTCTATTRAGQVVKYIQLNIRGELKIT 1062

  Fly   208 GGP-DLYVDKGSTINLTCI-------IKFSPEP-PTHIFWYHQDKVLSEETSGGRLKFKTIKSEE 263
            |.| .|.|.:|....|.|:       |::|... |....|:|                 |..||:
 Frog  1063 GPPTSLTVSEGEKAELRCVVSGQNANIQWSRNGLPVRSDWHH-----------------THVSED 1110

  Fly   264 TKSILLIYDADLLHSGKYSCYPSN-----TEIASIRVHVLQGERPEA 305
              ..|:|.:......|.|:|...|     :..|.||||   ..||.|
 Frog  1111 --GTLIIRNTKAADEGSYTCNAYNGAHSVSASADIRVH---KSRPTA 1152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 18/80 (23%)
IG_like 210..297 CDD:214653 25/101 (25%)
IGc2 217..287 CDD:197706 16/78 (21%)
paplnXP_004917291.1 PLAC 1164..1196 CDD:285849
TSP1 30..81 CDD:214559
ADAM_spacer1 186..299 CDD:283607
TSP1 309..362 CDD:214559
TSP1 387..445 CDD:214559
TSP1 448..501 CDD:214559
TSP1 507..562 CDD:214559
Kunitz_BPTI 701..753 CDD:278443
I-set 861..940 CDD:254352 22/93 (24%)
Ig 871..937 CDD:143165 20/80 (25%)
IG_like 976..1055 CDD:214653 8/79 (10%)
IGc2 984..1045 CDD:197706 8/61 (13%)
I-set 1060..1141 CDD:254352 22/100 (22%)
Ig 1076..1145 CDD:299845 19/88 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.