DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and obsl1

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_012826065.1 Gene:obsl1 XenbaseID:XB-GENE-5945765 Length:1338 Species:Xenopus tropicalis

Alignment Length:366 Identity:76/367 (21%)
Similarity:122/367 (33%) Gaps:124/367 (34%)


  Fly    68 GKSAYLGCRVKHLGNKTVAWIRH-------RDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIK 125
            |....|.|.:.. |:..:.|::.       :::.:...||                  ..||:..
 Frog   618 GDPLSLHCELSR-GSADLRWLKDGEELTPTQNIALEAAGT------------------RHTLRFL 663

  Fly   126 WAQQRDAGVYECQISTQPVRSYSVNL--NIVDLIDAE---------------------TSDIMQQ 167
            ..|..|||.|.|.:.... |.::||:  |.|.:::.|                     .:|...:
 Frog   664 SVQPEDAGQYHCNVGGDS-RVFTVNVDENRVRILEREQMVPRRFCTVSEDLRLALSLSRADAEVR 727

  Fly   168 YYND-----DAFYI-AENR-------------------VYQSSNDEFAGMFGPIQTVAV--PTAT 205
            :|.|     ||.:| .|.|                   :...|.|.|:..      |||  |..|
 Frog   728 WYKDGERLRDAPHILVEERGAECSLTILGLERADAGEYLCDVSRDSFSFY------VAVGDPPVT 786

  Fly   206 ILGG---PDLY-VDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKS 266
            |:|.   |:.: :..|..:.|||.:.   .|...:.|....:   |..|.||:|..........:
 Frog   787 IVGNTGTPEQHLLMTGDDLVLTCELS---RPNFKVRWLRNGE---ELVSAGRVKILARGVHRQLT 845

  Fly   267 ILLIYDADLLHSGKYSCYPSN------------------TEIASIRVHVLQGERPEAMQTNAAPA 313
            |..:...|   ||.|:|....                  ||:.:|.  ||:|| ..:.:...:|.
 Frog   846 IQNVRPGD---SGTYTCDAGTDQMHTSVYVEAPRVVEFVTELQNIT--VLEGE-TASFKCMVSPD 904

  Fly   314 AVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQS 354
            .|.|. |..: |....:.:..||....:     |.||.|:|
 Frog   905 DVDLR-WELN-GSPVYSDKRFSTTSTGM-----CHSLTLRS 938

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 15/82 (18%)
IG_like 210..297 CDD:214653 21/106 (20%)
IGc2 217..287 CDD:197706 17/70 (24%)
obsl1XP_012826065.1 IGc2 70..128 CDD:197706
IG_like 71..141 CDD:214653
IG_like 153..231 CDD:214653
IGc2 160..218 CDD:197706
IG 252..322 CDD:214652
Ig 255..>309 CDD:143165
IGc2 343..404 CDD:197706
IG 434..>491 CDD:214652
Ig 437..>491 CDD:143165
I-set 514..596 CDD:254352
Ig 526..583 CDD:299845
Ig_2 608..688 CDD:290606 18/90 (20%)
IG_like 611..688 CDD:214653 18/90 (20%)
Ig <723..767 CDD:299845 8/44 (18%)
IG_like 794..872 CDD:214653 18/87 (21%)
IGc2 802..859 CDD:197706 16/66 (24%)
Ig 881..970 CDD:299845 19/69 (28%)
IG_like 885..962 CDD:214653 17/65 (26%)
Ig 984..1052 CDD:143165
I-set 1057..1140 CDD:254352
Ig 1144..1215 CDD:299845
IG_like 1151..1229 CDD:214653
Ig 1235..>1301 CDD:299845
IG_like 1241..1318 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.