DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and nfasc

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_004910753.1 Gene:nfasc XenbaseID:XB-GENE-922969 Length:1338 Species:Xenopus tropicalis

Alignment Length:286 Identity:54/287 (19%)
Similarity:99/287 (34%) Gaps:72/287 (25%)


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI 117
            ||: |..|:|:....|::..|.||.......|:.|..:.|      .|.....:..|      :|
 Frog   350 PYW-LDEPKNLILAPGENGRLVCRASGSPKPTIQWFMNGD------ATEVGAPNPNF------EI 401

  Fly   118 DEWTLQIKWAQQRDAGVYECQISTQ---------------PVRSYSVNLNIVDLIDAETSDIMQQ 167
            ...|:..:..|..::.||:|..|.:               |.|.......::.:|:...:.:...
 Frog   402 AGDTIIFREVQSGNSAVYQCNASNEHGYLLANAFVSILDVPSRMLGPRNQLIRVIEYNRTQLDCP 466

  Fly   168 YY----------------NDDA--FYIAENRVYQ--SSNDEFAGMFGPIQT-------------V 199
            ::                |.|.  :.:.||...:  :...|..|.:..:.|             |
 Frog   467 FFGSPIPTLRWFKNGQGSNLDGGNYRVHENGTLEINTVRKEDQGKYTCVATNILGNAENTVRLEV 531

  Fly   200 AVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEET 264
            ..||..:.|..|....:||:::|.|.::........:.|...|..|   ....|:|    |.|:.
 Frog   532 KEPTRIVKGPEDQIAKRGSSVHLDCRVRSDSSLRLTVTWIKDDTQL---YINSRMK----KDEDG 589

  Fly   265 KSILLIYDADLLHSGKYSCYPSNTEI 290
            .:|..:.:.|   .|.|:|. :.||:
 Frog   590 LTIFGVAEKD---QGAYTCV-AKTEL 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 16/95 (17%)
IG_like 210..297 CDD:214653 19/82 (23%)
IGc2 217..287 CDD:197706 16/70 (23%)
nfascXP_004910753.1 IG_like 62..149 CDD:214653
Ig 72..148 CDD:299845
Ig 153..245 CDD:299845
IG_like 162..246 CDD:214653
IG_like 266..346 CDD:214653
Ig3_L1-CAM_like 277..347 CDD:143208
IG_like 356..438 CDD:214653 18/94 (19%)
Ig 364..439 CDD:299845 16/87 (18%)
IGc2 462..521 CDD:197706 7/59 (12%)
IG_like 463..531 CDD:214653 7/68 (10%)
I-set 536..622 CDD:254352 20/88 (23%)
Ig 551..622 CDD:299845 16/73 (22%)
FN3 640..730 CDD:238020
FN3 742..820 CDD:214495
fn3 840..932 CDD:278470
FN3 944..1035 CDD:238020
fn3 1109..1178 CDD:278470
Bravo_FIGEY 1230..1314 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.